Overview

  • Product name
  • Description
    Rabbit polyclonal to SAA1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Pig, Zebrafish
  • Immunogen

    Synthetic peptide within Mouse SAA1 aa 51-100 (internal sequence). The exact sequence is proprietary.
    Sequence:

    DKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEA


    Database link: NP_033143

  • Positive control
    • Mouse thymus lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab171030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 14 kDa.

Target

  • Relevance
    Major acute phase reactant. Apolipoprotein of the HDL complex.
  • Cellular localization
    Secreted
  • Database links
  • Alternative names
    • amyloid A, serum antibody
    • Amyloid fibril protein AA antibody
    • Amyloid protein A antibody
    • MGC111216 antibody
    • PIG4 antibody
    • SAA antibody
    • SAA2 antibody
    • Serum amyloid A protein antibody
    • serum amyloid A-1 protein antibody
    • serum amyloid A1 antibody
    • TP53I4 antibody
    • Tumor protein p53 inducible protein 4 antibody
    see all

Images

  • Anti-SAA1 antibody (ab171030) at 2 µg/ml + mouse thymus lysate at 10 µg

    Predicted band size: 14 kDa

References

This product has been referenced in:
  • Selvaraj S  et al. The pathogenesis of diclofenac induced immunoallergic hepatitis in a canine model of liver injury. Oncotarget 8:107763-107824 (2017). Read more (PubMed: 29296203) »

See 1 Publication for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Pig Tissue sections (Liver pig)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: citratbuffer
Permeabilization
No
Specification
Liver pig
Blocking step
HRP Polymer Kit as blocking agent for 5 minute(s) · Concentration: 3% · Temperature: RT°C
Username

Abcam user community

Verified customer

Submitted May 18 2018

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up