Overview

  • Product name

    Anti-SAA3 antibody [JOR110A]
  • Description

    Rat monoclonal [JOR110A] to SAA3
  • Host species

    Rat
  • Tested applications

    Suitable for: WB, IHC-P, IHC-Frmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse SAA3 aa 20-122.
    Sequence:

    RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGG AWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLP KRY


    Database link: P04918

  • Positive control

    • WB; RAW12 cells stimulated with LPS for 8, 12, 16 and 24 hours, supernatant; mouse SAA3-transfected HEK-293T supernatant. IHC-P: Mouse colitis, colon, adenocarcinoma, mesothelium, pneumonia and lung tissue; adipocytes in mouse adenocarcinoma tissue. IHC-Fr: Frozen cytospin preparation of MYC-tagged SAA3-transfected HEK-293T.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA
  • Concentration information loading...
  • Clonality

    Monoclonal
  • Clone number

    JOR110A
  • Isotype

    IgG2b

Applications

Our Abpromise guarantee covers the use of ab231680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/100. Predicted molecular weight: 14 kDa.
IHC-P 1/50.
IHC-Fr 1/50.

Images

  • Paraffin-embedded mouse colitis tissue stained for SAA3 using ab231680 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse colon tissue stained for SAA3 using ab231680 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse adenocarcinoma tissue stained for SAA3 using ab231680 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse mesothelium tissue stained for SAA3 using ab231680 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse pneumonia tissue stained for SAA3 using ab231680 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse lung tissue stained for SAA3 using ab231680 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse adipocytes in adenocarcinoma tissue stained for SAA3 using ab231680 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse adepocytes in SAA KO mouse stained for SAA3 using ab231680 at 1/50 dilution in immunohistochemical analysis.

  • Frozen cytospin preparation of MYC-tagged SAA1-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) stained for SAA3 using ab231680 at 1/50 dilution in immunohistochemical analysis.

  • Frozen cytospin preparation of MYC-tagged SAA2-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) stained for SAA3 using ab231680 at 1/50 dilution in immunohistochemical analysis (negative control).

  • Frozen MYC-tagged SAA3-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cytospin stained for SAA3 using ab231680 at 1/50 dilution in immunohistochemical analysis.

  • Frozen cytospin preparation of MYC-tagged SAA4-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) stained for SAA3 using ab231680 at 1/50 dilution in immunohistochemical analysis (negative control).

  • All lanes : Anti-SAA3 antibody [JOR110A] (ab231680) at 1/50 dilution

    Lane 1 : RAW12 stimulated with LPS for 8 hours supernatant at 20 µl
    Lane 2 : RAW12 stimulated with LPS for 12 hours supernatant at 20 µl
    Lane 3 : RAW12 stimulated with LPS for 16 hours supernatant at 20 µl
    Lane 4 : RAW12 stimulated with LPS for 24 hours supernatant at 20 µl
    Lane 5 : RAW12 supernatant at 20 µl
    Lane 6 : Mouse SAA3-GFP-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate at 20 µg

    Developed using the ECL technique.

    Predicted band size: 14 kDa

  • All lanes : Anti-SAA3 antibody [JOR110A] (ab231680) at 1/50 dilution

    Lane 1 : SAA1-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate at 10 µg
    Lane 2 : SAA2-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate at 10 µg
    Lane 3 : SAA3-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate at 10 µg
    Lane 4 : SAA4-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate at 10 µg
    Lane 5 : RAW12 supernatant at 20 µl
    Lane 6 : RAW12 stimulated with LPS for 12 hours supernatant at 20 µl

    Developed using the ECL technique.

    Predicted band size: 14 kDa

References

ab231680 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up