Anti-SACM1L/Sac1 antibody (ab221805)
Key features and details
- Rabbit polyclonal to SACM1L/Sac1
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SACM1L/Sac1 antibody
See all SACM1L/Sac1 primary antibodies -
Description
Rabbit polyclonal to SACM1L/Sac1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Orangutan -
Immunogen
Recombinant fragment corresponding to Human SACM1L/Sac1 aa 397-457.
Sequence:NVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIYKNAWADNANACA KQYAGTGALKT
Database link: Q9NTJ5 -
Positive control
- ICC/IF: U-2 OS cells.
-
General notes
This product was previously labelled as SACM1L
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab221805 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Phosphoinositide phosphatase that hydrolyzes PtdIns(3)P and PtdIns(4)P. Has low activity towards PtdIns(3,5)P2. -
Tissue specificity
Detected in heart, brain, lung, liver, kidney, pancreas and testis. -
Sequence similarities
Contains 1 SAC domain. -
Cellular localization
Endoplasmic reticulum membrane. - Information by UniProt
-
Database links
- Entrez Gene: 530577 Cow
- Entrez Gene: 22908 Human
- Entrez Gene: 83493 Mouse
- Entrez Gene: 100172954 Orangutan
- Entrez Gene: 116482 Rat
- Omim: 606569 Human
- SwissProt: A6QL88 Cow
- SwissProt: Q9NTJ5 Human
see all -
Alternative names
- Phosphatidylinositide phosphatase SAC1 antibody
- SAC1 antibody
- SAC1 suppressor of actin mutations 1-like (yeast) antibody
see all
Images
Protocols
Datasheets and documents
References (0)
ab221805 has not yet been referenced specifically in any publications.