Overview

  • Product name

  • Description

    Rabbit polyclonal to SAHH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human SAHH aa 2-432.
    Sequence:

    SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA GCLHMTVETAVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYA WKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIHTKYPQLLPGIR GISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLID GIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQ AAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGH FDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAM GHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGK LNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY


    Database link: P23526

  • Positive control

    • IHC-P: Human breast cancer tissue. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as S adenosylhomocysteine hydrolase

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236110 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Adenosylhomocysteine is a competitive inhibitor of S-adenosyl-L-methionine-dependent methyl transferase reactions; therefore adenosylhomocysteinase may play a key role in the control of methylations via regulation of the intracellular concentration of adenosylhomocysteine.
  • Pathway

    Amino-acid biosynthesis; L-homocysteine biosynthesis; L-homocysteine from S-adenosyl-L-homocysteine: step 1/1.
  • Involvement in disease

    Defects in AHCY are the cause of hypermethioninemia with S-adenosylhomocysteine hydrolase deficiency (HMAHCHD) [MIM:613752]. A metabolic disorder characterized by hypermethioninemia associated with failure to thrive, mental and motor retardation, facial dysmorphism with abnormal hair and teeth, and myocardiopathy.
  • Sequence similarities

    Belongs to the adenosylhomocysteinase family.
  • Cellular localization

    Cytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adenosylhomocysteinase antibody
    • AdoHcyase antibody
    • ahcY antibody
    • S adenosyl L homocysteine hydrolase antibody
    • S adenosylhomocysteine hydrolase antibody
    • S-adenosyl-L-homocysteine hydrolase antibody
    • SAHH antibody
    • SAHH_HUMAN antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for SAHH using ab236110 at 1/100 dilution in immunohistochemical analysis.

  • 4% formaldehyde-fixed, 0.2 Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells labeling SAHH using ab236110 (green) at 1/233 dilution in ICC/IF.

    Cells were blocked in 10% normal goat serum and incubated with primary antibody at 4°C overnight. Secondary antibody was Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L). Counter stained with DAPI (blue).

References

ab236110 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236110.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up