Overview

  • Product name

    Anti-Salivary alpha amylase antibody
    See all Salivary alpha amylase primary antibodies
  • Description

    Rabbit polyclonal to Salivary alpha amylase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Chicken, Dog, Human, Pig, Drosophila melanogaster
  • Immunogen

    Synthetic peptide corresponding to Rat Salivary alpha amylase aa 301-350 (internal sequence).
    Sequence:

    YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV

  • Positive control

    • Rat Heart lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab139994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa.

Target

  • Sequence similarities

    Belongs to the glycosyl hydrolase 13 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • amylase, salivary, B antibody
    • 1 4 alpha D glucan glucanohydrolase antibody
    • 1 antibody
    • 1,4 alpha D glucan glucanohydrolase 2B antibody
    • 1,4-alpha-D-glucan glucanohydrolase 1 antibody
    • 4-alpha-D-glucan glucanohydrolase 1 antibody
    • Alpha amylase antibody
    • Alpha-amylase 1 antibody
    • AMY1 antibody
    • AMY1_HUMAN antibody
    • AMY1C antibody
    • AMY2 antibody
    • AMY2B antibody
    • AMY3 antibody
    • amylase, alpha 1A (salivary) antibody
    • Amylase, alpha 1B (salivary) antibody
    • amylase, alpha 1C (salivary) antibody
    • amylase, salivary, alpha-1A antibody
    • amylase, salivary, alpha-1B antibody
    • amylase, salivary, alpha-1C antibody
    • amylase, salivary, C antibody
    • glycogenase antibody
    • HXA antibody
    • PA antibody
    • Salivary alpha-amylase antibody
    • salivary amylase alpha 1A antibody
    • salivary amylase alpha 1B antibody
    • salivary amylase alpha 1C antibody
    see all

Images

  • Anti-Salivary alpha amylase antibody (ab139994) at 1 µg/ml + Rat Heart lysates
    at 10 µg

    Predicted band size: 59 kDa

References

This product has been referenced in:

  • Gomi H  et al. Canine Salivary Glands: Analysis of Rab and SNARE Protein Expression and SNARE Complex Formation With Diverse Tissue Properties. J Histochem Cytochem 65:637-653 (2017). Read more (PubMed: 28914590) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up