Overview

  • Product name

    Anti-SALL2 antibody
  • Description

    Rabbit polyclonal to SALL2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human SALL2 aa 49-159.
    Sequence:

    FLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSN PPDSGSSVPTDPTWGPERRGEESSGHFLVAATGTAAGGGGGLILASPKLG ATPLPPESTPA


    Database link: Q9Y467

  • Positive control

    • IHC-P: Human cerebellum tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244275 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    The region-specific homeotic gene sal (spalt) of Drosophila encodes a zinc finger protein of unusual but characteristic structure. These unique features were used to isolate sal-like genes from humans. Two sal-like transcription units SALL1 and SALL2, located on chromosomes 16q12.1 and 14q11.1-q12.1 respectively, have been isolated and characterized. SALL1 and SALL2 transcripts are expressed in a limited number of adult organs, including the brain. SALL2 is evenly expressed in different brain areas. Transcripts of both genes can be detected in fetal brain neurons. The arrangement of sal-like zinc finger domains and their high degree of sequence similarity suggest a novel and conserved subfamily of human zinc finger transcription factors that is closely related to the Drosophila gene product encoded by the gene sal.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • AI225809 antibody
    • AW559097 antibody
    • FLJ10414 antibody
    • FLJ55746 antibody
    • HSAL2 antibody
    • KIAA0360 antibody
    • mKIAA0360 antibody
    • Msal-2 antibody
    • p150 Sal2 antibody
    • p150(Sal2) antibody
    • Sal like protein 2 antibody
    • Sal-2 antibody
    • Sal-like 2 (Drosophila) antibody
    • Sal-like 2 antibody
    • Spalt-like protein 2 antibody
    • Zinc finger protein SALL2 antibody
    • Zinc finger protein Spalt-2 antibody
    • ZNF795 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human cerebellum tissue stained for SALL2 using ab244275 at 1/50 dilution in immunohistochemical analysis.

References

ab244275 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244275.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up