Anti-Sall4 antibody [6E3] (ab57577)
Key features and details
- Mouse monoclonal [6E3] to Sall4
- Suitable for: WB, IHC-P, Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-Sall4 antibody [6E3]
See all Sall4 primary antibodies -
Description
Mouse monoclonal [6E3] to Sall4 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, Flow Cytmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Sall4 aa 954-1054.
Sequence:PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLG ATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS
Database link: Q9UJQ4 -
Positive control
- WB: HeLa cell lysate, IHC-P: human testis. Flow Cyt: HeLa cells.
-
General notes
This product was changed from ascites to tissue culture supernatant on 12th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.40
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
6E3 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab57577 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use at an assay dependent concentration. Predicted molecular weight: 112 kDa.
|
|
IHC-P | (4) |
Use at an assay dependent concentration.
|
Flow Cyt |
Use at an assay dependent concentration.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Notes |
---|
WB
Use at an assay dependent concentration. Predicted molecular weight: 112 kDa. |
IHC-P
Use at an assay dependent concentration. |
Flow Cyt
Use at an assay dependent concentration. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Target
-
Function
Probable transcription factor. -
Tissue specificity
Expressed in testis. -
Involvement in disease
Defects in SALL4 are the cause of Duane-radial ray syndrome (DRRS) [MIM:607323]; also known as Okihiro syndrome. DRRS is a disorder characterized by the association of forearm malformations with Duane retraction syndrome.
Defects in SALL4 are the cause of oculootoradial syndrome (OORS) [MIM:147750]. Oculootoradial syndrome is an autosomal dominant condition characterized by upper limbs anomalies (radial ray defects, carpal bones fusion), extraocular motor disturbances, congenital bilateral non-progressive mixed hearing loss. Other less consistent malformations include heart involvement, mild thrombocytopenia and leukocytosis (before age 50), shoulder girdle hypoplasia, imperforate anus, kidney malrotation or rectovaginal fistula. The IVIC syndrome is an allelic disorder of Duane-radial ray syndrome (DRRS) with a similar phenotype. -
Sequence similarities
Belongs to the sal C2H2-type zinc-finger protein family.
Contains 7 C2H2-type zinc fingers. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 57167 Human
- Omim: 607343 Human
- SwissProt: Q9UJQ4 Human
- Unigene: 517113 Human
-
Alternative names
- AA407717 antibody
- AL022809 antibody
- AW536104 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of testes from juvenile (PND 7 and PND 14) mice labeling Sall4 with ab57577. Testes were dissected and fixed in 4% PFA overnight at 4°C. Fixed tissues were processed for paraffin embedding and 5 µm serial sections were collected. Sections were deparaffinized in xylene (2×15 min), rehydrated in a graded ethanol series (2×100% for 10 min, 1×95% for 5 min, 1×80% for 5 min, 1×70% for 5 min, 1×50% for 5 min, 1×25% for 5 min) and rinsed in 1× DPBS. Slides were then incubated in sodium citrate antigen retrieval buffer (10 mM Sodium Citrate, 0.05% Tween-20, pH 6) for 30 min at 97.5°C and allowed to cool to room temperature. After rinsing twice in 1× DPBS containing 0.1% Tween-20 (DBPS-T), unspecific binding sites in tissue sections were saturated by incubation with blocking buffer (1× DPBS containing 3% bovine serum albumin, 0.1% Triton X-100 and 5% normal serum from the host species of the secondary antibody) for 30 min at room temperature. Primary antibodies were diluted in blocking buffer and added to tissue sections for 90 min at room temperature.
This image was generated using the ascites version of the product.
-
IHC-P image of Sall4 staining with ab57577 on tissue sections from adult mouse testis. The sections were subjected to heat-mediated antigen retrieval using Dako antigen retrieval solution. The sections were then blocked with 5% milk for 30 minutes at 25°C, before incubation with ab57577 (1/100 dilution) for 18 hours at 4°C. The secondary was an Alexa-Fluor 488 conjugated goat anti-mouse polyclonal, used at a 1/500 dilution.
This image was generated using the ascites version of the product.
-
Sall4 antibody (ab57577) at 1ug/lane + HeLa cell lysate at 25ug/lane.
This image was generated using the ascites version of the product.
-
Sall4 antibody (ab57577) used in immunohistochemistry at 5ug/ml on formalin fixed and paraffin embedded human testis.
This image was generated using the ascites version of the product.
-
Overlay histogram showing HeLa cells stained with ab57577 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab57577, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HeLa cells fixed with 4% paraformaldehyde/permeabilized in 0.1% PBS-Tween used under the same conditions.
This image was generated using the ascites version of the product.
-
IHC-P image of Sall4 staining with ab57577 on tissue sections from adult marmoset testis. The sections were subjected to heat-mediated antigen retrieval using Dako antigen retrieval solution. The sections were then blocked with 5% milk for 30 minutes at 25°C, before incubation with ab57577 (1/100 dilution) for 18 hours at 4°C. The secondary was an Alexa-Fluor 488 conjugated goat anti-mouse polyclonal, used at a 1/500 dilution.
This image was generated using the ascites version of the product.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (33)
ab57577 has been referenced in 33 publications.
- Irie T et al. IL-34 in hepatoblastoma cells potentially promote tumor progression via autocrine and paracrine mechanisms. Cancer Med 11:1441-1453 (2022). PubMed: 35132816
- Rodriguez-Polo I et al. A piggyBac-based platform for genome editing and clonal rhesus macaque iPSC line derivation. Sci Rep 11:15439 (2021). PubMed: 34326359
- Shimizu N et al. PLZF and its fusion proteins are pomalidomide-dependent CRBN neosubstrates. Commun Biol 4:1277 (2021). PubMed: 34764413
- Kong NR et al. Zinc Finger Protein SALL4 Functions through an AT-Rich Motif to Regulate Gene Expression. Cell Rep 34:108574 (2021). PubMed: 33406418
- Park HJ et al. Toxic Effects of Nonylphenol on Neonatal Testicular Development in Mouse Organ Culture. Int J Mol Sci 21:N/A (2020). PubMed: 32429066