Overview

  • Product name

    Anti-Salusin alpha antibody
    See all Salusin alpha primary antibodies
  • Description

    Rabbit polyclonal to Salusin alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Salusin alpha aa 34-293. (Expressed in E.coli).
    Sequence:

    RCSLGSFCECDFWPDLPGLECDLARHLAGQHLAKALVVKSLKAFVQDPAP SKPLVLSLHGWTGTGKSYVSSLLAQYLFRGGLRSPHVHHFSPIIHFPHPS HTEQYKNELKSWVQGNLTACGRSLFLFDEMDKLPPGLMEVLKPFLGPSWV VYGTNYRKAIFIFISNTGGEQINQVALEAWRSRRDREEISLQEVEPAVSQ AVLDNPHHGFWRSGIMEEQLLDAVVPFLPLQRHHVRHCVLNELAQLGLEP REEVVQAVLD


    Database link: Q6AYR4

  • Positive control

    • WB: Rat liver lysate; Recombinant rat Salusin alpha protein. IHC-P: Rat liver, lung, kidney, stomach and spleen tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab232904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Relevance

    Salusins are multifunctional bioactive peptides discovered by bioinformatics analyses of a full-length cDNA library. Salusin alpha and salusin beta are related peptides of 28 and 20 amino acids that were recently characterized. These peptides are considered to be biosynthesized from preprosalusin, an alternative-splicing product of the torsion dystonia-related gene (TOR2A), after frameshift reading and digestion at dibasic amino acids. Salusin alpha has recently been shown to be involved in atherosclerosis; it potently suppresses acyl-CoA:cholesterol acyltransferase-1 which stores cholesterol ester converted from free cholesterol in macrophages, thereby reducing human macrophage foam cell formation.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • prosalusin antibody
    • Prosalusin precursor antibody
    • TOR2A antibody
    • TORP1 antibody
    • Torsin 2A [Precursor] antibody
    • torsin 2A antibody
    • Torsin family 2 member A antibody
    • Torsin related protein 1 antibody
    see all

Images

  • Anti-Salusin alpha antibody (ab232904) at 2 µg/ml + Recombinant rat Salusin alpha protein
  • Anti-Salusin alpha antibody (ab232904) at 5 µg/ml + Rat liver lysate
  • Formalin-fixed, paraffin-embedded rat liver tissue stained for Salusin alpha using ab232904 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat lung tissue stained for Salusin alpha using ab232904 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for Salusin alpha using ab232904 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for Salusin alpha using ab232904 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat spleen tissue stained for Salusin alpha using ab232904 at 10 µg/ml in immunohistochemical analysis. DAB staining.

References

ab232904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up