Anti-Salusin alpha antibody (ab232928)
Key features and details
- Rabbit polyclonal to Salusin alpha
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Salusin alpha antibody
See all Salusin alpha primary antibodies -
Description
Rabbit polyclonal to Salusin alpha -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Mouse Salusin alpha aa 125-313. Expressed in E.coli. N-terminal tags.
Sequence:PIIHFPHPSRTEQYKKELKSWVQGNLTACGRSLFLFDEMDKLPPGLMEVL QPFLGPSWVVYGTNYRKAIFIFISNAGGEQINQVALEAWRSHRDREEISL QEVEPVISRAVMDNPQHGFWRSGIMEEHLLDAVVPFLPLQRHHVRHCVLN ELAQLGLEPSEEVVQAVLDSTTYFPEVEQLFSSNGCKTV
Database link: Q8R1J9 -
Positive control
- IHC-P: Mouse cardiac muscle and skin tissues. WB: Mouse serum; Mouse liver and heart lysates; Recombinant mouse Salusin alpha protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab232928 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab232928 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 36 kDa. |
Target
-
Relevance
Salusins are multifunctional bioactive peptides discovered by bioinformatics analyses of a full-length cDNA library. Salusin alpha and salusin beta are related peptides of 28 and 20 amino acids that were recently characterized. These peptides are considered to be biosynthesized from preprosalusin, an alternative-splicing product of the torsion dystonia-related gene (TOR2A), after frameshift reading and digestion at dibasic amino acids. Salusin alpha has recently been shown to be involved in atherosclerosis; it potently suppresses acyl-CoA:cholesterol acyltransferase-1 which stores cholesterol ester converted from free cholesterol in macrophages, thereby reducing human macrophage foam cell formation. -
Cellular localization
Secreted -
Database links
- Entrez Gene: 27433 Human
- Entrez Gene: 30933 Mouse
- Entrez Gene: 362112 Rat
- Omim: 608052 Human
- SwissProt: Q5JU69 Human
- SwissProt: Q8N2E6 Human
- SwissProt: P0C7W3 Mouse
- SwissProt: Q8R1J9 Mouse
see all -
Alternative names
- prosalusin antibody
- Prosalusin precursor antibody
- TOR2A antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Salusin alpha antibody (ab232928)
Paraffin-embedded mouse cardiac muscle tissue stained for Salusin alpha using ab232928 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-Salusin alpha antibody (ab232928) at 1 µg/ml + Mouse liver lysate
Secondary
HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
Predicted band size: 36 kDa -
Anti-Salusin alpha antibody (ab232928) at 1 µg/ml + Mouse heart lysate
Secondary
HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
Predicted band size: 36 kDa -
Anti-Salusin alpha antibody (ab232928) at 1 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
Secondary
HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
Predicted band size: 36 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Salusin alpha antibody (ab232928)
Formalin-fixed, paraffin-embedded mouse skin tissue stained for Salusin alpha using ab232928 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-Salusin alpha antibody (ab232928) at 1 µg/ml + Mouse serum
Secondary
HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
Predicted band size: 36 kDa -
Anti-Salusin alpha antibody (ab232928) at 2 µg/ml + Recombinant mouse Salusin alpha protein
Predicted band size: 36 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab232928 has not yet been referenced specifically in any publications.