Overview

  • Product name

    Anti-SAMM50/SAM50 antibody
    See all SAMM50/SAM50 primary antibodies
  • Description

    Rabbit polyclonal to SAMM50/SAM50
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human SAMM50/SAM50 aa 1-220.
    Sequence:

    MGTVHARSLEPLPSSGPDFGGLGEEAEFVEVEPEAKQEILENKDVVVQHV HFDGLGRTKDDIIICEIGDVFKAKNLIEVMRKSHEAREKLLRLGIFRQVD VLIDTCQGDDALPNGLDVTFEVTELRRLTGSYNTMVGNNEGSMVLGLKLP NLLGRAEKVTFQFSYGTKETSYGLSFFKPRPGNFERNFSVNLYKVTGQFP WSSLRETDRGMSAEYSFPIW


    Database link: Q9Y512

  • Positive control

    • WB: Mouse gonadal lysate; A-375, A431, HEK-293T, HeLa, A549, HepG2, U-251 MG and LO2 whole cell lysates. IHC-P: Human liver cancer and skeletal muscle tissues.
  • General notes

     This product was previously labelled as SAMM50

     

Properties

Applications

Our Abpromise guarantee covers the use of ab235308 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 52 kDa.

Target

  • Function

    May be required for the assembly pathway of mitochondrial outer membrane proteins.
  • Sequence similarities

    Belongs to the SAM50/omp85 family.
  • Domain

    Its C-terminal part seems to contain many membrane-spanning sided beta-sheets, that have the potential to adopt a transmembrane beta-barrel type structure.
  • Cellular localization

    Mitochondrion outer membrane. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CGI 51 antibody
    • CGI-51 antibody
    • FLJ35825 antibody
    • FLJ42905 antibody
    • FLJ99036 antibody
    • OMP85 antibody
    • SAM50 antibody
    • SAM50_HUMAN antibody
    • Samm50 antibody
    • sorting and assembly machinery 50kDa antibody
    • sorting and assembly machinery component 50 homolog (S. cerevisiae) antibody
    • Sorting and assembly machinery component 50 homolog antibody
    • sorting and assembly machinery component 50, S. cerevisiae, homolog of antibody
    • TOB55 antibody
    • Transformation-related gene 3 protein antibody
    • TRG-3 antibody
    • YNL026W antibody
    see all

Images

  • All lanes : Anti-SAMM50/SAM50 antibody (ab235308) at 1/1000 dilution

    Lane 1 : Mouse gonadal lysate
    Lane 2 : A-375 (human malignant melanoma cell line) whole cell lysate
    Lane 3 : A431 (human epidermoid carcinoma cell line) whole cell lysate
    Lane 4 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 5 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 6 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 7 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 8 : U-251 MG (human brain glioma cell line) whole cell lysate
    Lane 9 : LO2 (human immortal liver cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 52 kDa

  • Paraffin-embedded human liver cancer tissue stained for SAMM50/SAM50 using ab235308 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skeletal muscle tissue stained for SAMM50/SAM50 using ab235308 at 1/100 dilution in immunohistochemical analysis.

References

ab235308 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235308.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up