Anti-SAMM50/SAM50 antibody (ab246987)
Key features and details
- Rabbit polyclonal to SAMM50/SAM50
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-SAMM50/SAM50 antibody
See all SAMM50/SAM50 primary antibodies -
Description
Rabbit polyclonal to SAMM50/SAM50 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow -
Immunogen
Recombinant fragment corresponding to Human SAMM50/SAM50 aa 5-104.
Sequence:HARSLEPLPSSGPDFGGLGEEAEFVEVEPEAKQEILENKDVVVQHVHFDG LGRTKDDIIICEIGDVFKAKNLIEVMRKSHEAREKLLRLGIFRQVDVLID
Database link: Q9Y512 -
Positive control
- WB: HL-60, NIH/3T3 and NBT-II whole cell lysates. IHC-P: Human parathyroid gland, pancreas, small intestine, testis and kidney tissue. ICC/IF: A431 cells.
-
General notes
This product was previously labelled as SAMM50
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab246987 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 52 kDa. | |
IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
May be required for the assembly pathway of mitochondrial outer membrane proteins. -
Sequence similarities
Belongs to the SAM50/omp85 family. -
Domain
Its C-terminal part seems to contain many membrane-spanning sided beta-sheets, that have the potential to adopt a transmembrane beta-barrel type structure. -
Cellular localization
Mitochondrion outer membrane. Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 618777 Cow
- Entrez Gene: 25813 Human
- Entrez Gene: 68653 Mouse
- Entrez Gene: 300111 Rat
- Omim: 612058 Human
- SwissProt: Q2HJ55 Cow
- SwissProt: Q9Y512 Human
- SwissProt: Q8BGH2 Mouse
see all -
Alternative names
- CGI 51 antibody
- CGI-51 antibody
- FLJ35825 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMM50/SAM50 antibody (ab246987)
Formalin-fixed, paraffin-embedded human pancreas tissue stained for SAMM50 with ab246987 at a 1/1000 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMM50/SAM50 antibody (ab246987)
Formalin-fixed, paraffin-embedded human kidney tissue stained for SAMM50 with ab246987 at a 1/1000 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMM50/SAM50 antibody (ab246987)
Formalin-fixed, paraffin-embedded human testis tissue stained for SAMM50 with ab246987 at a 1/1000 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMM50/SAM50 antibody (ab246987)
Formalin-fixed, paraffin-embedded human small intestine tissue stained for SAMM50 with ab246987 at a 1/1000 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMM50/SAM50 antibody (ab246987)
Formalin-fixed, paraffin-embedded human parathyroid gland tissue stained for SAMM50 with ab246987 at a 1/1000 dilution in immunohistochemical analysis.
-
PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for SAMM50/SAM50 (green) using ab246987 at 4 μg/ml in ICC/IF.
-
All lanes : Anti-SAMM50/SAM50 antibody (ab246987) at 0.4 µg/ml
Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
Lane 2 : NBT-II (rat Wistar bladder tumor cell line) whole cell lysate
Predicted band size: 52 kDa -
Anti-SAMM50/SAM50 antibody (ab246987) at 0.4 µg + HL-60 (human promyelocytic leukemia cell line) whole cell lysate
Predicted band size: 52 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab246987 has not yet been referenced specifically in any publications.