Anti-SAMM50/SAM50 antibody (ab246987)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SAMM50/SAM50 antibody
See all SAMM50/SAM50 primary antibodies -
Description
Rabbit polyclonal to SAMM50/SAM50 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow
-
Immunogen
Recombinant fragment corresponding to Human SAMM50/SAM50 aa 5-104.
Sequence:HARSLEPLPSSGPDFGGLGEEAEFVEVEPEAKQEILENKDVVVQHVHFDG LGRTKDDIIICEIGDVFKAKNLIEVMRKSHEAREKLLRLGIFRQVDVLID
Database link: Q9Y512 -
Positive control
- WB: HL-60, NIH/3T3 and NBT-II whole cell lysates. IHC-P: Human parathyroid gland tissue. ICC/IF: A431 cells.
-
General notes
This product was previously labelled as SAMM50
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab246987 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.4 µg/ml. Predicted molecular weight: 52 kDa. | |
| IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
May be required for the assembly pathway of mitochondrial outer membrane proteins. -
Sequence similarities
Belongs to the SAM50/omp85 family. -
Domain
Its C-terminal part seems to contain many membrane-spanning sided beta-sheets, that have the potential to adopt a transmembrane beta-barrel type structure. -
Cellular localization
Mitochondrion outer membrane. Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 618777 Cow
- Entrez Gene: 25813 Human
- Entrez Gene: 68653 Mouse
- Entrez Gene: 300111 Rat
- Omim: 612058 Human
- SwissProt: Q2HJ55 Cow
- SwissProt: Q9Y512 Human
- SwissProt: Q8BGH2 Mouse
see all -
Alternative names
- CGI 51 antibody
- CGI-51 antibody
- FLJ35825 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-SAMM50/SAM50 antibody (ab246987)PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for SAMM50/SAM50 (green) using ab246987 at 4 μg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMM50/SAM50 antibody (ab246987)Paraffin-embedded human parathyroid gland tissue stained for SAMM50/SAM50 using ab246987 at 1/500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMM50/SAM50 antibody (ab246987)Paraffin-embedded human pancreas tissue stained for SAMM50/SAM50 using ab246987 at 1/500 dilution in immunohistochemical analysis. Low expression, as expected.
-
Western blot - Anti-SAMM50/SAM50 antibody (ab246987)All lanes : Anti-SAMM50/SAM50 antibody (ab246987) at 0.4 µg/ml
Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
Lane 2 : NBT-II (rat Wistar bladder tumor cell line) whole cell lysate
Predicted band size: 52 kDa -
Western blot - Anti-SAMM50/SAM50 antibody (ab246987)Anti-SAMM50/SAM50 antibody (ab246987) at 0.4 µg + HL-60 (human promyelocytic leukemia cell line) whole cell lysate
Predicted band size: 52 kDa
Datasheets and documents
References
ab246987 has not yet been referenced specifically in any publications.
