Overview

  • Product name

    Anti-SAMSN1 antibody [OTI7F5]
    See all SAMSN1 primary antibodies
  • Description

    Mouse monoclonal [OTI7F5] to SAMSN1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SAMSN1 aa 1-250. (NP_071419) produced in E.coli.
    Sequence:

    MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPT NGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGEN AHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRD SFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPM GMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKANRRSNSKKSKTLQEFL


    Database link: Q9NSI8

  • Positive control

    • WB: HEK-293T transfected with pCMV6-ENTRY SAMSN1, whole cell lysate. IHC-P: Human lymphoma and tonsil tissue.
  • General notes

    Clone OTI7F5 (formerly 7F5).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI7F5
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236410 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/150.

Heat-induced epitope retrieval by 1 mM EDTA in 10 mM Tris buffer (pH 8.5) at 120°C for 3 minutes.

WB 1/2000. Predicted molecular weight: 42 kDa.

Target

  • Function

    Negative regulator of B-cell activation. Down-regulates cell proliferation (in vitro). Promotes RAC1-dependent membrane ruffle formation and reorganization of the actin cytoskeleton. Regulates cell spreading and cell polarization. Stimulates HDAC1 activity. Regulates LYN activity by modulating its tyrosine phosphorylation.
  • Tissue specificity

    Detected in peripheral blood B-cells (at protein level). Detected in spleen, liver and peripheral blood.
  • Sequence similarities

    Contains 1 SAM (sterile alpha motif) domain.
    Contains 1 SH3 domain.
  • Cellular localization

    Nucleus. Cytoplasm. Cell projection > ruffle. Shuttles between cytoplasm and nucleus. Colocalizes with the actin cytoskeleton and actin-rich membrane ruffles.
  • Information by UniProt
  • Database links

  • Alternative names

    • HACS1 antibody
    • Hematopoietic adapter containing SH3 and sterile α motif (SAM) domains 1 antibody
    • Hematopoietic adapter containing SH3 and sterile alpha motif (SAM) domains 1 antibody
    • Hematopoietic adaptor containing SH3 and SAM domains 1 antibody
    • Nash1 antibody
    • Nuclear localization signals SAM and SH3 domain containing 1 antibody
    • SAM and SH3 domain containing 2 antibody
    • SAM domain antibody
    • SAM domain containing protein SAMSN 1 antibody
    • SAM domain SH3 domain and nuclear localisation signals 1 antibody
    • SAM domain SH3 domain and nuclear localization signals 1 antibody
    • SAM domain, SH3 domain and nuclear localization signals protein 1 antibody
    • SAM domain-containing protein SAMSN-1 antibody
    • SAMN1_HUMAN antibody
    • SAMSN 1 antibody
    • Samsn1 antibody
    • SASH2 antibody
    • SH3 domain and nuclear localisation signals 1 antibody
    • SH3 domain and nuclear localization signals protein 1 antibody
    • SH3 SAM adaptor protein antibody
    • SH3-SAM adaptor protein antibody
    • SH3D6B antibody
    • SLy2 antibody
    • Src homology domain 3 (SH3) containing adapter protein SH3 lymphocyte protein 2 antibody
    see all

Images

  • All lanes : Anti-SAMSN1 antibody [OTI7F5] (ab236410) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY control, whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY SAMSN1, whole cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 42 kDa

  • Paraffin-embedded human lymphoma tissue stained for SAMSN1 using ab236410 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human tonsil tissue stained for SAMSN1 using ab236410 at 1/150 dilution in immunohistochemical analysis.

References

ab236410 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236410.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up