Overview

  • Product name

  • Description

    Rabbit polyclonal to SAP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse SAP1 aa 685-909. Expressed in E. coli. N-terminal tags.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-QSQITASALENRS KNRYRNVLPYDWSRVPLQPLQEEPGSDYINASFMPGLWSPKEFIATQGPL PNTVGDFWRMVWEQQSHTLVMLTNCMESGRVKCEHYWPLDAQPCIHGQLQ VMLISEEASENWTVRHLQLFHMKEQQTLSLRQFHYLAWPDHGVPYSPDPL LAFRKMLRQWMDQTTDGGPPIVHCSAGVGRTGTLIALDVLLRQLECEGLV GPFSFVKKMRES


    Database link: E9Q0N2

  • Positive control

    • IHC-P: Mouse spleen tissue. WB: Recombinant mouse SAP1 protein. Mouse cerebrum lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231727 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May contribute to contact inhibition of cell growth and motility by mediating the dephosphorylation of focal adhesion-associated substrates and thus negatively regulating integrin-promoted signaling processes. Induces apoptotic cell death by at least two distinct mechanisms: inhibition of cell survival signaling mediated by PI 3-kinase, Akt, and ILK and activation of a caspase-dependent proapoptotic pathway. Inhibits the basal activity of LCK and its activation in response to TCR stimulation and TCR-induced activation of MAP kinase and surface expression of CD69. Inhibits TCR-induced tyrosine phosphorylation of LAT and ZAP70. Inhibits both basal activity of DOK1 and its CD2-induced tyrosine phosphorylation. Induces dephosphorylation of p130cas, focal adhesion kinase and c-Src. Reduces migratory activity of Jurkat cells.
  • Tissue specificity

    Expressed at high levels in the brain, spleen and liver and at lower levels in the heart and stomach. Expressed in pancreatic and colorectal cancer cells, but not in normal pancreas or colon. Expression in hepatocellular carcinoma is related to the differentiation status of the tumor and expression is inversely related to tumor aggressiveness.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Receptor class 3 subfamily.
    Contains 8 fibronectin type-III domains.
    Contains 1 tyrosine-protein phosphatase domain.
  • Domain

    The extracellular domain mediates homodimerization. One or more cysteines in the extracellular domain is essential for the formation of dimers probably by forming a disulfide bond.
    The cytoplasmic domain mediates the interaction with LCK.
  • Cellular localization

    Membrane. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • BEM 2 antibody
    • BEM2 antibody
    • Brain-enriched membrane-associated protein tyrosine phosphatase 2 antibody
    • Phosphotyrosine phosphatase antibody
    • Protein tyrosine phosphatase receptor type H antibody
    • PTPASE antibody
    • PTPRH antibody
    • PTPRH_HUMAN antibody
    • R-PTP-H antibody
    • Receptor-type tyrosine-protein phosphatase H antibody
    • SAP-1 antibody
    • SAP1 antibody
    • Stomach cancer-associated protein tyrosine phosphatase 1 antibody
    • Transmembrane-type protein tyrosine phosphatase H antibody
    • Transmembrane-type protein-tyrosine phosphatase type H antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse spleen tissue stained for SAP1 with ab231727 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-SAP1 antibody (ab231727) at 2 µg/ml + Mouse cerebrum tissue lysate
  • Anti-SAP1 antibody (ab231727) at 2 µg/ml + Recombinant mouse SAP1 protein

References

ab231727 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231727.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up