Overview

  • Product name

  • Description

    Rabbit polyclonal to SAP102
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human SAP102 aa 627-802. (Expressed in E.coli).
    Sequence:

    ARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFV VSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGN AIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIYDKAMKLEQE FGEYFTAIVQGDSLEEIYNKIKQIIE


    Database link: Q92796

  • Positive control

    • WB: Recombinant human SAP102 protein; Rat and pig brain lysates. IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233223 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 90 kDa.

Target

  • Function

    Required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling.
  • Involvement in disease

    Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90) [MIM:300189]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs.
  • Sequence similarities

    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 3 PDZ (DHR) domains.
    Contains 1 SH3 domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA291O7.3 antibody
    • bA291O7.3 discs large Drosophila homolog 3 neuroendocrine dlg antibody
    • Discs large Drosophila homolog 3 antibody
    • Discs large homolog 3 neuroendocrine dlg Drosophila antibody
    • Discs large homolog 3 antibody
    • Discs large homolog 3 Drosophila antibody
    • Discs, large homolog 3 (Drosophila) antibody
    • Disks large homolog 3 antibody
    • DLG 3 antibody
    • Dlg3 antibody
    • DLG3_HUMAN antibody
    • KIAA1232 antibody
    • mKIAA1232 antibody
    • MRX 90 antibody
    • MRX antibody
    • MRX90 antibody
    • NE Dlg antibody
    • NEDLG antibody
    • Neuroendocrine dlg antibody
    • Neuroendocrine-DLG antibody
    • OTTHUMP00000023475 antibody
    • OTTHUMP00000023476 antibody
    • OTTHUMP00000023477 antibody
    • SAP 102 antibody
    • SAP-102 antibody
    • SAP102 antibody
    • Synapse associated protein 102 antibody
    • Synapse-associated protein 102 antibody
    • XLMR antibody
    see all

Images

  • Anti-SAP102 antibody (ab233223) at 2 µg/ml + Recombinant human SAP102 protein

    Predicted band size: 90 kDa

  • All lanes : Anti-SAP102 antibody (ab233223) at 2 µg/ml

    Lane 1 : Pig brain lysate
    Lane 2 : Rat brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution

    Predicted band size: 90 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for SAP102 using ab233223 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab233223 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233223.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up