Overview

  • Product name

  • Description

    Rabbit polyclonal to SAP30
  • Host species

    Rabbit
  • Tested applications

    Suitable for: CHIPseq, WB, ChIPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human SAP30 aa 1-220.
    Sequence:

    MNGFTPDEMSRGGDAAAAVAAVVAAAAAAASAGNGTGAGTGAEVPGAGAV SAAGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKI ELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDL YQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYF IYSVKNDKNKSDLKVDSGVH


    Database link: O75446

  • Positive control

    • WB: Nuclear extracts from HeLa cells. ChIP: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab231804 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
CHIPseq Use at an assay dependent concentration.

Chromatin from 4 million cells using 5 μg of antibody.

WB 1/1000.
ChIP Use at an assay dependent concentration.

2 - 5 µg/ChIP reaction.

Target

  • Function

    Involved in the functional recruitment of the Sin3-histone deacetylase complex (HDAC) to a specific subset of N-CoR corepressor complexes. Capable of transcription repression by N-CoR. Active in deacetylating core histone octamers (when in a complex) but inactive in deacetylating nucleosomal histones.
  • Tissue specificity

    Expressed in all tissues tested with highest levels in pancreas, ovary, PBL, spleen and thymus; lowest levels in brain, placenta, lung and kidney.
  • Sequence similarities

    Belongs to the SAP30 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 30 kDa Sin3-associated polypeptide antibody
    • Histone deacetylase complex subunit SAP 30 antibody
    • Histone deacetylase complex subunit SAP30 antibody
    • MSin3A associated polypeptide p30 antibody
    • SAP 30 antibody
    • Sap30 antibody
    • SAP30_HUMAN antibody
    • Sin3 associated polypeptide 30 kDa antibody
    • Sin3 associated polypeptide 30kD antibody
    • Sin3 associated polypeptide antibody
    • Sin3 corepressor complex subunit SAP 30 antibody
    • Sin3 corepressor complex subunit SAP30 antibody
    • Sin3-associated polypeptide p30 antibody
    • Sin3A associated protein 30kDa antibody
    • Sin3A associated protein antibody
    see all

Images

  • Anti-SAP30 antibody (ab231804) at 1/1000 dilution + HeLa (Human epithelial cell line from cervix adenocarcinoma) nuclear extracts at 20 µg


    Dilution buffer: TBS-Tween containing 5% skimmed milk. 

  • ChIP assays were performed using HeLa (Human epithelial cell line from cervix adenocarcinoma) cells, ab231804 and optimized primer sets for qPCR. ChIP was performed using sheared chromatin from 4 million cells. A titration of the antibody consisting of 1, 2 and 5 µg per ChIP experiment was analysed. IgG (1 µg/ IP) was used as negative IP control. QPCR was performed with primers for the EIF2S3 and BRCA1 promoters, used as positive controls, and for the MYOD1 gene and the Sat2 satellite repeat, used as negative controls. Image shows the recovery, expressed as a % of input (the relative amount of immunoprecipitated DNA compared to input DNA after qPCR analysis).

  • ChIP was performed on sheared chromatin from 4 million HeLa (Human epithelial cell line from cervix adenocarcinoma) cells using 5 µg ab231804. The IP’d DNA was subsequently analysed on an Illumina HiSeq. Library preparation, cluster generation and sequencing were performed according to the manufacturer’s instructions. The 50 bp tags were aligned to the human genome using the BWA algorithm. Image shows the enrichment along the complete sequence and a 1.5 Mb region of human chromosome 1 (A and B) and in two genomic regions surrounding the BRCA1 and EIF2S3 genes on chromosome 17 and X, respectively (C and D).

References

ab231804 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231804.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up