Overview

  • Product name

  • Description

    Rabbit polyclonal to SAP30BP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human SAP30BP aa 99-182.
    Sequence:

    QELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMD MNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYP


    Database link: Q9UHR5

  • Positive control

    • Human kidney tissue. MCF7 cells. LY415705 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab204320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 34 kDa.

Target

  • Function

    Induces cell death. May act as a transcriptional corepressor of a gene related to cell survival. May be involved in the regulation of beta-2-microglobulin genes.
  • Sequence similarities

    Belongs to the HCNGP family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • HCNGP antibody
    • HSV 1 binding antibody
    • HSV-1 binding transcriptional regulator protein antibody
    • HSV1 binding antibody
    • HTRG antibody
    • HTRP antibody
    • Human transcriptional regulator protein antibody
    • S30BP_HUMAN antibody
    • SAP 30 binding protein antibody
    • SAP30 binding protein antibody
    • SAP30-binding protein antibody
    • SAP30BP antibody
    • Transcriptional regulator protein HCNGP antibody
    see all

Images

  • Immunofluorescent analysis of MCF7 cells (PFA-fixed/Triton X-100 permeabilized) labeling SAP30BP with ab204320 at 4 µg/ml.

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue, labeling SAP30BP with ab204320 at 1/200 dilution.

  • All lanes : Anti-SAP30BP antibody (ab204320) at 1/100 dilution

    Lane 1 : Negative Control
    Lane 2 : LY415705 cell lysate

    Developed using the ECL technique.

    Predicted band size: 34 kDa

References

ab204320 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up