Overview

  • Product name

  • Description

    Rabbit polyclonal to SARA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SARA aa 427-518.
    Sequence:

    QPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSN GCDSYGMQDPGVSFVPKTLPSKEDSVTEEKEIEESKSECYSN


    Database link: O95405

  • Positive control

    • RT4 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221488 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Early endosomal protein that functions to recruit SMAD2/SMAD3 to intracellular membranes and to the TGF-beta receptor. Plays a significant role in TGF-mediated signaling by regulating the subcellular location of SMAD2 and SMAD3 and modulating the transcriptional activity of the SMAD3/SMAD4 complex. Possibly associated with TGF-beta receptor internalization.
  • Tissue specificity

    Ubiquitous. In the brain found primarily in the cerebrovascular smooth muscle cells and reactive astrocytes.
  • Sequence similarities

    Contains 1 FYVE-type zinc finger.
  • Domain

    The SMAD binding domain (SBD) interacts with the MH2 domains of SMAD2 or SMAD3.
    The FYVE-type zinc finger is necessary and sufficient for its localization into early endosomes and mediates the association with PI3P.
  • Cellular localization

    Cytoplasm. Early endosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CG15667 antibody
    • hSARA antibody
    • LD33044p antibody
    • Madh-interacting protein antibody
    • MADHIP antibody
    • Mothers against decapentaplegic homolog-interacting protein antibody
    • Novel serine protease antibody
    • NSP antibody
    • Receptor activation anchor antibody
    • SAR1 antibody
    • SARA antibody
    • SARA1 antibody
    • Smad anchor for receptor activation antibody
    • SMADIP antibody
    • ZFYV9_HUMAN antibody
    • ZFYVE9 antibody
    • Zinc finger FYVE domain-containing protein 9 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized RT4 cells labeling SARA with ab221488 at 4 μg/ml (green).

References

ab221488 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221488.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up