Overview

  • Product name
    Anti-Sarcosine Oxidase / PSO antibody
    See all Sarcosine Oxidase / PSO primary antibodies
  • Description
    Mouse polyclonal to Sarcosine Oxidase / PSO
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Cow, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla
  • Immunogen

    Full length protein corresponding to Human Sarcosine Oxidase/ PSO aa 1-390.
    Sequence:

    MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHG QSRIIRKAYLEDFYTRMMHECYQIWAQLEHEAGTQLHRQTGLLLLGMKEN QELKTIQANLSRQRVEHQCLSSEELKQRFPNIRLPRGEVGLLDNSGGVIY AYKALRALQDAIRQLGGIVRDGEKVVEINPGLLVTVKTTSRSYQAKSLVI TAGPWTNQLLRPLGIEMPLQTLRINVCYWREMVPGSYGVSQAFPCFLWLG LCPHHIYGLPTGEYPGLMKVSYHHGNHADPEERDCPTARTDIGDVQILSS FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG FKLAPVVGKILYELSMKLTPSYDLAPFRISRFPSLGKAHL

  • Positive control
    • Sarcosine Oxidase / PSO-transfected 293T cell lysate.
  • General notes

    Previously labelled as Sarcosine Oxidase. 

Properties

Applications

Our Abpromise guarantee covers the use of ab169102 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 44 kDa.

Target

  • Function
    Metabolizes sarcosine, L-pipecolic acid and L-proline.
  • Sequence similarities
    Belongs to the MSOX/MTOX family.
  • Cellular localization
    Peroxisome.
  • Information by UniProt
  • Database links
  • Alternative names
    • L pipecolate oxidase antibody
    • L pipecolic acid oxidase antibody
    • L-pipecolate oxidase antibody
    • L-pipecolic acid oxidase antibody
    • LPIPOX antibody
    • Peroxisomal sarcosine oxidase antibody
    • Pipecolic acid and sarcosine oxidase antibody
    • Pipecolic acid oxidase antibody
    • PIPOX antibody
    • PSO antibody
    • Sarcosine Oxidase antibody
    • Sarcosine oxidase subunit alpha antibody
    • SOX_HUMAN antibody
    see all

Images

  • All lanes : Anti-Sarcosine Oxidase / PSO antibody (ab169102) at 1/500 dilution

    Lane 1 : Sarcosine Oxidase / PSO-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 44 kDa

References

ab169102 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169102.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up