Overview

  • Product name

    Anti-Sarcosine Oxidase/PSO antibody
    See all Sarcosine Oxidase/PSO primary antibodies
  • Description

    Rabbit polyclonal to Sarcosine Oxidase/PSO
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit
  • Immunogen

    Recombinant fragment corresponding to Human Sarcosine Oxidase/PSO aa 259-337.
    Sequence:

    LPTGEYPGLMKVSYHHGNHADPEERDCPTARTDIGDVQILSSFVRDHLPD LKPEPAVIESCMYTNTPDEQFILDRHPKY


    Database link: Q9P0Z9

  • Positive control

    • WB: Rat kidney and liver lysates; Mouse brain lysate. IHC-P: Human liver cancer tissue and tonsil tissues.
  • General notes

    Previously labelled as Sarcosine Oxidase. 

Properties

Applications

Our Abpromise guarantee covers the use of ab223508 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 45 kDa (predicted molecular weight: 44 kDa).
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human tonsil tissue stained for Sarcosine Oxidase/PSO using ab223508 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-Sarcosine Oxidase/PSO antibody (ab223508) at 1/500 dilution

    Lane 1 : Rat kidney lysate
    Lane 2 : Rat liver lysate
    Lane 3 : Mouse brain lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 44 kDa
    Observed band size: 45 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human liver cancer tissue stained for Sarcosine Oxidase/PSO using ab223508 at 1/100 dilution in immunohistochemical analysis.

References

ab223508 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223508.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up