Anti-SARM antibody (ab217933)
Key features and details
- Rabbit polyclonal to SARM
- Suitable for: IHC-P
- Reacts with: Mouse
- Isotype: IgG
Overview
-
Product name
Anti-SARM antibody
See all SARM primary antibodies -
Description
Rabbit polyclonal to SARM -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Mouse
Predicted to work with: Rat, Human -
Immunogen
Synthetic peptide within Human SARM aa 340-380 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:EAQCIGAFYLCAEAAIKSLQGKTKVFSDIGAIQSLKRLVSY
Database link: Q6SZW1 -
Positive control
- Mouse liver and kidney tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab217933 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Involved in innate immnune response. Acts as a negative regulator of TICAM1/TRIF-dependent Toll-like receptor signaling by inhibiting induction of TLR3- and TLR4-dependent genes. Specifically blocks TICAM1/TRIF-dependent transcription-factor activation and gene induction, without affecting the MYD88-dependent pathway or non-TLR signaling. Negative regulator of NF-kappa-B and IRF activation. -
Tissue specificity
Predominantly expressed in kidney and liver. Expressed at lower level in placenta. -
Sequence similarities
Contains 2 SAM (sterile alpha motif) domains.
Contains 1 TIR domain. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 23098 Human
- Entrez Gene: 237868 Mouse
- Entrez Gene: 287545 Rat
- Omim: 607732 Human
- SwissProt: Q6SZW1 Human
- SwissProt: Q6PDS3 Mouse
- Unigene: 446689 Human
- Unigene: 743510 Human
see all -
Alternative names
- FLJ36296 antibody
- KIAA0524 antibody
- MyD88-5 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SARM antibody (ab217933)
Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse liver ssue, labeling SARM using ab217933 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SARM antibody (ab217933)
Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse kidney tissue, labeling SARM using ab217933 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
Datasheets and documents
References (0)
ab217933 has not yet been referenced specifically in any publications.