Anti-SARM antibody (ab217933)

Submit a review Submit a question
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SARM antibody (ab217933)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SARM antibody (ab217933)

Key features and details

  • Rabbit polyclonal to SARM
  • Suitable for: IHC-P
  • Reacts with: Mouse
  • Isotype: IgG

Overview

  • Product name

    Anti-SARM antibody
    See all SARM primary antibodies

  • Description

    Rabbit polyclonal to SARM

  • Host species

    Rabbit

  • Tested applications

    Suitable for: IHC-Pmore details

  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human

  • Immunogen

    Synthetic peptide within Human SARM aa 340-380 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    EAQCIGAFYLCAEAAIKSLQGKTKVFSDIGAIQSLKRLVSY


    Database link: Q6SZW1
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • Mouse liver and kidney tissues.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab217933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Involved in innate immnune response. Acts as a negative regulator of TICAM1/TRIF-dependent Toll-like receptor signaling by inhibiting induction of TLR3- and TLR4-dependent genes. Specifically blocks TICAM1/TRIF-dependent transcription-factor activation and gene induction, without affecting the MYD88-dependent pathway or non-TLR signaling. Negative regulator of NF-kappa-B and IRF activation.

  • Tissue specificity

    Predominantly expressed in kidney and liver. Expressed at lower level in placenta.

  • Sequence similarities

    Contains 2 SAM (sterile alpha motif) domains.
    Contains 1 TIR domain.

  • Cellular localization

    Cytoplasm.
  • Information by UniProt

  • Database links

    see all

  • Alternative names

    • FLJ36296 antibody
    • KIAA0524 antibody
    • MyD88-5 antibody
    • SAM and ARM-containing protein antibody
    • SAM domain-containing protein 2 antibody
    • SAMD2 antibody
    • SARM 1 antibody
    • SARM1 antibody
    • SARM1_HUMAN antibody
    • Sterile alpha and Armadillo repeat protein antibody
    • sterile alpha and HEAT/Armadillo motif protein, ortholog of Drosophila antibody
    • sterile alpha and HEAT/Armadillo motifs-containing protein antibody
    • sterile alpha and TIR motif containing 1 antibody
    • Sterile alpha and TIR motif-containing protein 1 antibody
    • Sterile alpha and TIR motifs-containing protein 1 antibody
    • Sterile alpha motif domain-containing protein 2 antibody
    • Tir-1 homolog antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SARM antibody (ab217933)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SARM antibody (ab217933)

    Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse liver ssue, labeling SARM using ab217933 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SARM antibody (ab217933)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SARM antibody (ab217933)

    Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse kidney tissue, labeling SARM using ab217933 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References (0)

Publishing research using ab217933? Please let us know so that we can cite the reference in this datasheet.

ab217933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab217933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com