Anti-SARM antibody (ab217933)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SARM antibody
See all SARM primary antibodies -
Description
Rabbit polyclonal to SARM -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Mouse
Predicted to work with: Rat, Human
-
Immunogen
Synthetic peptide within Human SARM aa 340-380 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:EAQCIGAFYLCAEAAIKSLQGKTKVFSDIGAIQSLKRLVSY
Database link: Q6SZW1 -
Positive control
- Mouse liver and kidney tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab217933 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Involved in innate immnune response. Acts as a negative regulator of TICAM1/TRIF-dependent Toll-like receptor signaling by inhibiting induction of TLR3- and TLR4-dependent genes. Specifically blocks TICAM1/TRIF-dependent transcription-factor activation and gene induction, without affecting the MYD88-dependent pathway or non-TLR signaling. Negative regulator of NF-kappa-B and IRF activation. -
Tissue specificity
Predominantly expressed in kidney and liver. Expressed at lower level in placenta. -
Sequence similarities
Contains 2 SAM (sterile alpha motif) domains.
Contains 1 TIR domain. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 23098 Human
- Entrez Gene: 237868 Mouse
- Entrez Gene: 287545 Rat
- Omim: 607732 Human
- SwissProt: Q6SZW1 Human
- SwissProt: Q6PDS3 Mouse
- Unigene: 446689 Human
- Unigene: 743510 Human
see all -
Alternative names
- FLJ36296 antibody
- KIAA0524 antibody
- MyD88-5 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SARM antibody (ab217933)Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse liver ssue, labeling SARM using ab217933 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SARM antibody (ab217933)Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse kidney tissue, labeling SARM using ab217933 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
Protocols
Datasheets and documents
References
ab217933 has not yet been referenced specifically in any publications.
