Anti-SASS6 antibody (ab244411)
Key features and details
- Rabbit polyclonal to SASS6
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SASS6 antibody
See all SASS6 primary antibodies -
Description
Rabbit polyclonal to SASS6 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human SASS6 aa 423-513.
Sequence:QKEQKELQDVGQSLRIKEQEVCKLQEQLEATVKKLEESKQLLKNNEKLIT WLNKELNENQLVRKQDVLGPSTTPPAHSSSNTIRSGISPNL
Database link: Q6UVJ0 -
Positive control
- IHC-P: Human kidney tissue. ICC/IF: U-251 MG cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab244411 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
SASS6 (Spindle assembly abnormal protein 6 homolog) is required for centrosome duplication. It functions to ensure that each centriole seeds the formation of a single procentriole per cell cycle. Overexpression results in excess foci bearing centriolar markers. -
Cellular localization
Cytoplasm; cytoskeleton; centrosome. Cytoplasm; cytoskeleton; centrosome; centriole. Note: Component of the centrosome. Associated only transiently with nascent procentrioles during centriole biogenesis. -
Database links
- Entrez Gene: 163786 Human
- Omim: 609321 Human
- SwissProt: Q6UVJ0 Human
- Unigene: 591447 Human
-
Alternative names
- 2810453L12Rik antibody
- FLJ22097 antibody
- HsSAS 6 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SASS6 antibody (ab244411)Paraffin-embedded human kidney tissue stained for SASS6 using ab244411 at 1/20 dilution in immunohistochemical analysis.
-
PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for SASS6 (green) using ab244411 at 4 µg/ml in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244411 has not yet been referenced specifically in any publications.