Anti-SASS6 antibody (ab244411)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SASS6 antibody
See all SASS6 primary antibodies -
Description
Rabbit polyclonal to SASS6 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human SASS6 aa 423-513.
Sequence:QKEQKELQDVGQSLRIKEQEVCKLQEQLEATVKKLEESKQLLKNNEKLIT WLNKELNENQLVRKQDVLGPSTTPPAHSSSNTIRSGISPNL
Database link: Q6UVJ0 -
Positive control
- IHC-P: Human kidney tissue. ICC/IF: U-251 MG cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab244411 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
SASS6 (Spindle assembly abnormal protein 6 homolog) is required for centrosome duplication. It functions to ensure that each centriole seeds the formation of a single procentriole per cell cycle. Overexpression results in excess foci bearing centriolar markers. -
Cellular localization
Cytoplasm; cytoskeleton; centrosome. Cytoplasm; cytoskeleton; centrosome; centriole. Note: Component of the centrosome. Associated only transiently with nascent procentrioles during centriole biogenesis. -
Database links
- Entrez Gene: 163786 Human
- Omim: 609321 Human
- SwissProt: Q6UVJ0 Human
- Unigene: 591447 Human
-
Alternative names
- 2810453L12Rik antibody
- FLJ22097 antibody
- HsSAS 6 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SASS6 antibody (ab244411)Paraffin-embedded human kidney tissue stained for SASS6 using ab244411 at 1/20 dilution in immunohistochemical analysis. -
Immunocytochemistry/ Immunofluorescence - Anti-SASS6 antibody (ab244411)PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for SASS6 (green) using ab244411 at 4 µg/ml in ICC/IF.
Datasheets and documents
References
ab244411 has not yet been referenced specifically in any publications.
