Anti-SAV1 antibody (ab172705)
Key features and details
- Mouse polyclonal to SAV1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SAV1 antibody
See all SAV1 primary antibodies -
Description
Mouse polyclonal to SAV1 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Full length protein corresponding to Human SAV1 aa 1-383.
Sequence:MLSRKKTKNEVSKPAEVQGKYVKKETSPLLRNLMPSFIRHGPTIPRRTDI CLPDSSPNAFSTSGDVVSRNQSFLRTPIQRTPHEIMRRESNRLSAPSYLA RSLADVPREYGSSQSFVTEVSFAVENGDSGSRYYYSDNFFDGQRKRPLGD RAHEDYRYYEYNHDLFQRMPQNQGRHASGIGRVAATSLGNLTNHGSEDLP LPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLEREGLPPGWERVESSEFGT YYVDHTNKKAQYRHPCAPSVPRYDQPPPVTYQPQQTERNQSLLVPANPYH TAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQI VKMYEAYRQALLTELENRKQRQQWYAQQHGKNF
Database link: NP_068590.1 -
Positive control
- SAV1 transfected 293T cell lysate
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab172705 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa. |
Target
-
Function
Regulator of STK3/MST2 and STK4/MST1 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. SAV1 is required for STK3/MST2 and STK4/MST1 activation and promotes cell-cycle exit and terminal differentiation in developing epithelial tissues. Plays a role in centrosome disjunction by regulating the localization of NEK2 to centrosomes, and its ability to phosphorylate CROCC and CEP250. In conjunction with STK3/MST2, activates the transcriptional activity of ESR1 through the modulation of its phosphorylation. -
Tissue specificity
Ubiquitously expressed in adult tissues with highest expression in the pancreas, aorta and interventricular septum and lowest expression in skeletal muscle. Expression was higher in fetal than in the adult heart. Expressed in various cell lines. -
Sequence similarities
Contains 1 SARAH domain.
Contains 2 WW domains. -
Post-translational
modificationsPhosphorylated by STK3/MST2 and STK4/MST1. Phosphorylation is not required for SAV1 stability and may increase the number of protein binding sites on the scaffold molecule. -
Cellular localization
Nucleus. Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 60485 Human
- Entrez Gene: 64010 Mouse
- Entrez Gene: 299116 Rat
- Omim: 607203 Human
- SwissProt: Q9H4B6 Human
- SwissProt: Q8VEB2 Mouse
- SwissProt: A4V8B4 Rat
- Unigene: 642842 Human
see all -
Alternative names
- 1700040G09Rik antibody
- 45 kDa WW domain protein antibody
- hWW 45 antibody
see all
Images
-
All lanes : Anti-SAV1 antibody (ab172705) at 1 µg/ml
Lane 1 : SAV1 transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-mouse HRP at 1/2500 dilution
Predicted band size: 45 kDa
Datasheets and documents
References (0)
ab172705 has not yet been referenced specifically in any publications.