For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    sav1-antibody-ab172705.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Protein Phosphorylation Ser / Thr Kinases Other Kinases
Share by email

Anti-SAV1 antibody (ab172705)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-SAV1 antibody (ab172705)

    Key features and details

    • Mouse polyclonal to SAV1
    • Suitable for: WB
    • Reacts with: Human
    • Isotype: IgG

    You may also be interested in

    Secondary
    Product image
    Goat Anti-Mouse IgG H&L (HRP) (ab205719)

    View more associated products

    Overview

    • Product name

      Anti-SAV1 antibody
      See all SAV1 primary antibodies
    • Description

      Mouse polyclonal to SAV1
    • Host species

      Mouse
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Rat
    • Immunogen

      Full length protein corresponding to Human SAV1 aa 1-383.
      Sequence:

      MLSRKKTKNEVSKPAEVQGKYVKKETSPLLRNLMPSFIRHGPTIPRRTDI CLPDSSPNAFSTSGDVVSRNQSFLRTPIQRTPHEIMRRESNRLSAPSYLA RSLADVPREYGSSQSFVTEVSFAVENGDSGSRYYYSDNFFDGQRKRPLGD RAHEDYRYYEYNHDLFQRMPQNQGRHASGIGRVAATSLGNLTNHGSEDLP LPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLEREGLPPGWERVESSEFGT YYVDHTNKKAQYRHPCAPSVPRYDQPPPVTYQPQQTERNQSLLVPANPYH TAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQI VKMYEAYRQALLTELENRKQRQQWYAQQHGKNF


      Database link: NP_068590.1
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • SAV1 transfected 293T cell lysate
    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.4
      Constituent: 100% PBS
    • Concentration information loading...
    • Purity

      Protein A purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Signal Transduction
      • Protein Phosphorylation
      • Ser / Thr Kinases
      • Other Kinases

    Associated products

    • Compatible Secondaries

      • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
      • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Isotype control

      • Mouse IgG - Isotype Control (ab37355)

    Applications

    Our Abpromise guarantee covers the use of ab172705 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa.

    Target

    • Function

      Regulator of STK3/MST2 and STK4/MST1 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. SAV1 is required for STK3/MST2 and STK4/MST1 activation and promotes cell-cycle exit and terminal differentiation in developing epithelial tissues. Plays a role in centrosome disjunction by regulating the localization of NEK2 to centrosomes, and its ability to phosphorylate CROCC and CEP250. In conjunction with STK3/MST2, activates the transcriptional activity of ESR1 through the modulation of its phosphorylation.
    • Tissue specificity

      Ubiquitously expressed in adult tissues with highest expression in the pancreas, aorta and interventricular septum and lowest expression in skeletal muscle. Expression was higher in fetal than in the adult heart. Expressed in various cell lines.
    • Sequence similarities

      Contains 1 SARAH domain.
      Contains 2 WW domains.
    • Post-translational
      modifications

      Phosphorylated by STK3/MST2 and STK4/MST1. Phosphorylation is not required for SAV1 stability and may increase the number of protein binding sites on the scaffold molecule.
    • Cellular localization

      Nucleus. Cytoplasm.
    • Target information above from: UniProt accession Q9H4B6 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 60485 Human
      • Entrez Gene: 64010 Mouse
      • Entrez Gene: 299116 Rat
      • Omim: 607203 Human
      • SwissProt: Q9H4B6 Human
      • SwissProt: Q8VEB2 Mouse
      • SwissProt: A4V8B4 Rat
      • Unigene: 642842 Human
      • Unigene: 706933 Human
      • Unigene: 390480 Mouse
      • Unigene: 14087 Rat
      see all
    • Alternative names

      • 1700040G09Rik antibody
      • 45 kDa WW domain protein antibody
      • hWW 45 antibody
      • hWW45 antibody
      • Protein salvador homolog 1 antibody
      • salvador family WW domain containing protein 1 antibody
      • salvador homolog 1 (Drosophila) antibody
      • Salvador homolog 1 antibody
      • Salvador, Drosophila, homolog of antibody
      • SAV 1 antibody
      • SAV antibody
      • SAV1 antibody
      • SAV1_HUMAN antibody
      • WW 45 antibody
      • WW domain containing antibody
      • WW domain-containing adaptor 45 antibody
      • WW domain-containing protein, 45-KD antibody
      • WW45 antibody
      • WW45 protein antibody
      • WWP 4 antibody
      • WWP4 antibody
      see all

    Images

    • Western blot - Anti-SAV1 antibody (ab172705)
      Western blot - Anti-SAV1 antibody (ab172705)
      All lanes : Anti-SAV1 antibody (ab172705) at 1 µg/ml

      Lane 1 : SAV1 transfected 293T cell lysate
      Lane 2 : Non-transfected 293T cell lysate

      Lysates/proteins at 15 µl per lane.

      Secondary
      All lanes : Goat Anti-mouse HRP at 1/2500 dilution

      Predicted band size: 45 kDa

    Protocols

    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab172705? Please let us know so that we can cite the reference in this datasheet.

    ab172705 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab172705.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.