Overview

  • Product name

  • Description

    Rabbit polyclonal to SAV1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human SAV1 aa 1-210.
    Sequence:

    MLSRKKTKNEVSKPAEVQGKYVKKETSPLLRNLMPSFIRHGPTIPRRTDI CLPDSSPNAFSTSGDVVSRNQSFLRTPIQRTPHEIMRRESNRLSAPSYLA RSLADVPREYGSSQSFVTEVSFAVENGDSGSRYYYSDNFFDGQRKRPLGD RAHEDYRYYEYNHDLFQRMPQNQGRHASGIGRVAATSLGNLTNHGSEDLP LPPGWSVDWT


    Database link: Q9H4B6

  • Positive control

    • IHC-P: Human endometrial cancer and kidney tissue. ICC/IF: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Regulator of STK3/MST2 and STK4/MST1 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. SAV1 is required for STK3/MST2 and STK4/MST1 activation and promotes cell-cycle exit and terminal differentiation in developing epithelial tissues. Plays a role in centrosome disjunction by regulating the localization of NEK2 to centrosomes, and its ability to phosphorylate CROCC and CEP250. In conjunction with STK3/MST2, activates the transcriptional activity of ESR1 through the modulation of its phosphorylation.
  • Tissue specificity

    Ubiquitously expressed in adult tissues with highest expression in the pancreas, aorta and interventricular septum and lowest expression in skeletal muscle. Expression was higher in fetal than in the adult heart. Expressed in various cell lines.
  • Sequence similarities

    Contains 1 SARAH domain.
    Contains 2 WW domains.
  • Post-translational
    modifications

    Phosphorylated by STK3/MST2 and STK4/MST1. Phosphorylation is not required for SAV1 stability and may increase the number of protein binding sites on the scaffold molecule.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1700040G09Rik antibody
    • 45 kDa WW domain protein antibody
    • hWW 45 antibody
    • hWW45 antibody
    • Protein salvador homolog 1 antibody
    • salvador family WW domain containing protein 1 antibody
    • salvador homolog 1 (Drosophila) antibody
    • Salvador homolog 1 antibody
    • Salvador, Drosophila, homolog of antibody
    • SAV 1 antibody
    • SAV antibody
    • SAV1 antibody
    • SAV1_HUMAN antibody
    • WW 45 antibody
    • WW domain containing antibody
    • WW domain-containing adaptor 45 antibody
    • WW domain-containing protein, 45-KD antibody
    • WW45 antibody
    • WW45 protein antibody
    • WWP 4 antibody
    • WWP4 antibody
    see all

Images

  • A549 (human lung carcinoma cell line) cells stained for SAV1 (green) using ab230265 at 1/100 dilution in ICC/IF. Secondary used is an Alexa Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human kidney tissue stained for SAV1 using ab230265 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrial cancer tissue stained for SAV1 using ab230265 at 1/100 dilution in immunohistochemical analysis.

References

ab230265 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230265.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up