Overview

  • Product name

  • Description

    Rabbit polyclonal to SBSN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human SBSN aa 434-590. Expressed in E. coli. N-terminal tags.
    Sequence:

    GKEGDIAVHGVQPGVHEAGKEAGQFGQGVHHTLEQAGKEADKAVQGFHTG VHQAGKEAEKLGQGVNHAADQAGKEVEKLGQGAHHAAGQAGKELQNAHNG VNQASKEANQLLNGNHQSGSSSHQGGATTTPLASGASVNTPFINLPALWR SVANIMP


    Database link: Q6UWP8

  • Positive control

    • WB: Recombinant human SBSN protein; human serum and urine; Jurkat whole cell and pig skin tissue lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 61 kDa.

Target

  • Relevance

    The function of this protein remains unknown.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • HLAR698 antibody
    • Suprabasin antibody
    • UNQ698 antibody

Images

  • All lanes : Anti-SBSN antibody (ab232771) at 1 µg/ml

    Lane 1 : Human serum
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : Human urine
    Lane 4 : Pig skin tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 61 kDa

  • Anti-SBSN antibody (ab232771) at 1 µg/ml + Recombinant human SBSN protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 61 kDa

References

ab232771 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up