Anti-SCAP2/SAPS antibody (ab224602)
Key features and details
- Rabbit polyclonal to SCAP2/SAPS
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SCAP2/SAPS antibody -
Description
Rabbit polyclonal to SCAP2/SAPS -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow, Orangutan -
Immunogen
Recombinant fragment corresponding to Human SCAP2/SAPS aa 1-120.
Sequence:MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIK KIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAP SDGAQFPPIAAQDLPFVLKA
Database link: O75563 -
Positive control
- IHC: Human colon cancer tissue.
-
General notes
This product was previously labelled as SCAP2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab224602 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. |
Target
-
Function
May be involved in B-cell and macrophage adhesion processes. In B-cells, may act by coupling the B-cell receptor (BCR) to integrin activation. May play a role in src signaling pathway. -
Tissue specificity
Ubiquitously expressed. Present in platelets (at protein level). -
Sequence similarities
Belongs to the SKAP family.
Contains 1 PH domain.
Contains 1 SH3 domain. -
Domain
The SH3 domain interacts with FYB and PTK2B. -
Post-translational
modificationsPhosphorylated in resting platelets. Phosphorylated by FYN on Tyr-261 upon T-cell activation (Probable). Dephosphorylated on Tyr-75 by PTPN22. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 616545 Cow
- Entrez Gene: 8935 Human
- Entrez Gene: 54353 Mouse
- Entrez Gene: 100171875 Orangutan
- Omim: 605215 Human
- SwissProt: Q32LP7 Cow
- SwissProt: O75563 Human
- SwissProt: Q3UND0 Mouse
see all -
Alternative names
- Fyn associated phosphoprotein SKAP55 homologue antibody
- MGC10411 antibody
- MGC33 antibody
see all
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab224602 has not yet been referenced specifically in any publications.