Overview

  • Product name

    Anti-SCDGFB/PDGF-D antibody
    See all SCDGFB/PDGF-D primary antibodies
  • Description

    Rabbit polyclonal to SCDGFB/PDGF-D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SCDGFB/PDGF-D aa 191-370.
    Sequence:

    SGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMY LDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANV VFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKR RGRAKTMALVDIQLDHHERCDCICSSRPPR


    Database link: Q9GZP0-1

  • Positive control

    • IHC-P: Human adrenal gland and pancreas tissue.
  • General notes

    Previously labelled as SCDGFB. 

Properties

Applications

Our Abpromise guarantee covers the use of ab238335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Potent mitogen for cells of mesenchymal origin. Binding of this growth factor to its affinity receptor elicits a variety of cellular responses. It is released by platelets upon wounding and plays an important role in stimulating adjacent cells to grow and thereby heals the wound. Activated by proteolytic cleavage and this active form acts as a specific ligand for beta platelet-derived growth factor receptor. Induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis.
  • Tissue specificity

    Expressed at high levels in the heart, pancreas, adrenal gland and ovary and at low levels in placenta, liver, kidney, prostate, testis, small intestine, spleen and colon. In the kidney, expressed by the visceral epithelial cells of the glomeruli. A widespread expression is also seen in the medial smooth muscle cells of arteries and arterioles, as well as in smooth muscle cells of vasa rectae in the medullary area. Expressed in the adventitial connective tissue surrounding the suprarenal artery. In chronic obstructive nephropathy, a persistent expression is seen in glomerular visceral epithelial cells and vascular smooth muscle cells, as well as de novo expression by periglomerular interstitial cells and by some neointimal cells of arteriosclerotic vessels. Expression in normal prostate is seen preferentially in the mesenchyme of the gland while expression is increased and more profuse in prostate carcinoma. Expressed in many ovarian, lung, renal and brain cancer-derived cell lines.
  • Sequence similarities

    Belongs to the PDGF/VEGF growth factor family.
    Contains 1 CUB domain.
  • Developmental stage

    Not detectable in the earliest stages of glomerulogenesis, and not detected in the metanephric blastema or surrounding cortical interstitial cells. In later stages of glomerulogenesis, localized to epithelial cells transitioning from the early developing nephrons of the comma- and S-shaped stages to the visceral epithelial cells of differentiated glomeruli. In the developing pelvis, expressed at the basement membrane of immature collecting ducts and by presumptive fibroblastic cells in the interstitium.
  • Post-translational
    modifications

    Proteolytic removal of the N-terminal CUB domain releasing the core domain is necessary for unmasking the receptor-binding epitopes of the core domain. Cleavage after Arg-247 or Arg-249 by urokinase plasminogen activator gives rise to the active form.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • IEGF antibody
    • Iris expressed growth factor antibody
    • Iris-expressed growth factor antibody
    • MGC26867 antibody
    • MSTP036 antibody
    • PDGF D antibody
    • PDGF-D antibody
    • PDGFD antibody
    • PDGFD latent form antibody
    • PDGFD receptor-binding form antibody
    • PDGFD_HUMAN antibody
    • Platelet derived growth factor D antibody
    • Platelet-derived growth factor D antibody
    • receptor-binding form antibody
    • rSCDGF-B antibody
    • SCDGF B antibody
    • SCDGF-B antibody
    • SCDGFB antibody
    • Spinal cord derived growth factor B antibody
    • Spinal cord-derived growth factor B antibody
    • spinal-cord derived growth factor-B protein antibody
    see all

Images

  • Paraffin-embedded human adrenal gland tissue stained for SCDGFB/PDGF-D using ab238335 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for SCDGFB/PDGF-D using ab238335 at 1/100 dilution in immunohistochemical analysis.

References

ab238335 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up