Overview

  • Product name

    Anti-SCEL antibody
  • Description

    Rabbit polyclonal to SCEL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SCEL aa 496-668. (BC047536)
    Sequence:

    PEIFTNNQRNQDLANLIKVNPAVIRNNQSQDLDNLIKVKPSALRNTNRDQ NLENLIEVNSHVSENKNGSSNTGAKQAGPQDTVVYTRTYVENSKSPKDGY QENISGKYIQTVYSTSDRSVIERDMCTYCRKPLGVETKMILDELQICCHS TCFKCEICKQPLENLQAGDSIWIYRQTIHCEPCYSKIMAKWIP


    Database link: O95171

  • Positive control

    • Esophageal cancer tissue. A549, 7721, B16, SK-HEP-1 and SW620 lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab197087 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 78 kDa.

Target

  • Function

    May function in the assembly or regulation of proteins in the cornified envelope. The LIM domain may be involved in homotypic or heterotypic associations and may function to localize sciellin to the cornified envelope.
  • Tissue specificity

    Highly expressed in esophagus. It is also expressed in keratinocytes, amniotic tissue, foreskin stratum spinosum and stratum granulosum, hair follicle and nail.
  • Sequence similarities

    Contains 1 LIM zinc-binding domain.
  • Cellular localization

    Cytoplasm. Membrane. May become cross-linked to membrane proteins by transglutaminase.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ21667 antibody
    • MGC22531 antibody
    • Scel antibody
    • SCEL_HUMAN antibody
    • Sciellin antibody
    see all

Images

  • All lanes : Anti-SCEL antibody (ab197087) at 1/500 dilution

    Lane 1 : A549 lysate
    Lane 2 : 7721 lysate
    Lane 3 : B16 lysate
    Lane 4 : SK-HEP-1 lysate
    Lane 5 : SW620 lysate

    Predicted band size: 78 kDa

  • Immunohistochemical analysis of formalin/PFA-fixed, paraffin-embedded esophageal cancer tissue sections labeling SCEL with ab197087 at a 1/100 dilution.

References

ab197087 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197087.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up