Overview

  • Product name

  • Description

    Rabbit polyclonal to SCGF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human SCGF aa 22-323. Mature full length chain without signal peptide.
    Sequence:

    ARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVE GKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAG LHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREH GRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQME ALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPE LGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEF PF


    Database link: Q9Y240

  • Positive control

    • IHC-P: Human kidney and brain tissues. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Stimulates the proliferation and differentiation of hematopoietic precursor cells from various lineages, including erythrocytes, lymphocytes, granulocytes and macrophages. Acts synergistically with other cytokines, including IL-3, GCSF, GMCSF and FLT3 ligand. Suppresses SCF-stimulated erythrocyte proliferation.
  • Tissue specificity

    Expressed in skeletal tissues including bone marrow, chondrocytes, primary ossification center-associated cells, the perichondrium and periosteum. Lower levels of expression were detected in spleen, thymus, appendix and fetal liver.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Developmental stage

    In the bone marrow, expression is limited to immature neutrophils. Expression was not detected in circulating mature neutrophils.
  • Post-translational
    modifications

    O-glycosylated. Probably sulfated on the O-glycans.
  • Cellular localization

    Cytoplasm. Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 3 antibody
    • C type lectin domain family 11 member A antibody
    • C type lectin superfamily member 3 antibody
    • C-type lectin domain family 11 member A antibody
    • C-type lectin superfamily member 3 antibody
    • CLC11_HUMAN antibody
    • CLEC11A antibody
    • CLECSF3 antibody
    • LSLCL antibody
    • Lymphocyte secreted C type lectin antibody
    • Lymphocyte secreted C-type lectin antibody
    • lymphocyte secreted long form of C type lectin antibody
    • p47 antibody
    • Stem cell growth factor antibody
    • stem cell growth factor lymphocyte secreted C type lectin antibody
    see all

Images

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for SCGF (green) using ab238830 at 1/100 dilution in ICC/IF, followed by Alexa Fluor®488 conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human kidney tissue stained for SCGF using ab238830 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for SCGF using ab238830 at 1/100 dilution in immunohistochemical analysis.

References

ab238830 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up