Overview

  • Product name

    Anti-SCGN/Secretagogin antibody
    See all SCGN/Secretagogin primary antibodies
  • Description

    Rabbit polyclonal to SCGN/Secretagogin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human SCGN/Secretagogin aa 1-276. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGT DDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRR ENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKL EEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKR DFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILL RHCDVNKDGKIQKSELALCLGLKINP


    Database link: O76038

  • Positive control

    • WB: Pig stomach lysate; Recombinant human SCGN/Secretagogin protein. IHC-P: Human stomach, prostate and pancreas tissue.
  • General notes

     This product was previously labelled as SCGN

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233481 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Tissue specificity

    Expressed at high levels in the pancreatic islets of Langerhans and to a much lesser extent in the gastrointestinal tract (stomach, small intestine and colon), the adrenal medulla and cortex and the thyroid C-cells. In the brain, the expression is restricted to distinct subtypes of neurons with highest expression in the molecular layer of the cerebellum (stellate and basket cells), in the anterior part of the pituitary gland, in the thalamus, in the hypothalamus and in a subgroup of neocortical neurons.
  • Sequence similarities

    Contains 6 EF-hand domains.
  • Cellular localization

    Cytoplasm. Secreted. Cytoplasmic vesicle > secretory vesicle membrane. Predominantly cytoplasmic. A small proportion is associated with secretory granules and membrane fractions (By similarity). Detectable in human serum after ischemic neuronal damage.
  • Information by UniProt
  • Database links

  • Alternative names

    • Calbindin like antibody
    • CALBL antibody
    • DJ501N12.8 antibody
    • OTTHUMP00000016124 antibody
    • Scgn antibody
    • SECRET antibody
    • Secretagogin antibody
    • Secretagogin EF hand calcium binding protein antibody
    • SEGN antibody
    • SEGN_HUMAN antibody
    • Setagin antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for SCGN/Secretagogin using ab233481 at 10 µg/ml in immunohistochemical analysis. DAB staining. 

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for SCGN/Secretagogin using ab233481 at 10 µg/ml in immunohistochemical analysis. DAB staining. 

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for SCGN/Secretagogin using ab233481 at 10 µg/ml in immunohistochemical analysis. DAB staining. 

  • Anti-SCGN/Secretagogin antibody (ab233481) at 3 µg/ml + Pig stomach tissue lysate
  • Anti-SCGN/Secretagogin antibody (ab233481) at 2 µg/ml + Recombinant human SCGN/Secretagogin protein

References

ab233481 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233481.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up