Anti-SCGN/Secretagogin antibody [CL0271] (ab244219)
Key features and details
- Mouse monoclonal [CL0271] to SCGN/Secretagogin
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-SCGN/Secretagogin antibody [CL0271]
See all SCGN/Secretagogin primary antibodies -
Description
Mouse monoclonal [CL0271] to SCGN/Secretagogin -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human SCGN/Secretagogin aa 135-273.
Sequence:RDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENF LLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQ PSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLK
Database link: O76038 -
Positive control
- IHC-P: Human pancreas, cerebellum and duodenum tissues. WB: Human brain tissue lysate.
-
General notes
This product was previously labelled as SCGN
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
CL0271 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab244219 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa. |
Target
-
Tissue specificity
Expressed at high levels in the pancreatic islets of Langerhans and to a much lesser extent in the gastrointestinal tract (stomach, small intestine and colon), the adrenal medulla and cortex and the thyroid C-cells. In the brain, the expression is restricted to distinct subtypes of neurons with highest expression in the molecular layer of the cerebellum (stellate and basket cells), in the anterior part of the pituitary gland, in the thalamus, in the hypothalamus and in a subgroup of neocortical neurons. -
Sequence similarities
Contains 6 EF-hand domains. -
Cellular localization
Cytoplasm. Secreted. Cytoplasmic vesicle > secretory vesicle membrane. Predominantly cytoplasmic. A small proportion is associated with secretory granules and membrane fractions (By similarity). Detectable in human serum after ischemic neuronal damage. - Information by UniProt
-
Database links
- Entrez Gene: 10590 Human
- Omim: 609202 Human
- SwissProt: O76038 Human
- Unigene: 116428 Human
-
Alternative names
- Calbindin like antibody
- CALBL antibody
- DJ501N12.8 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SCGN/Secretagogin antibody [CL0271] (ab244219)
Paraffin-embedded human duodenum tissue stained for SCGN/Secretagogin using ab244219 at 1/2500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SCGN/Secretagogin antibody [CL0271] (ab244219)
Paraffin-embedded human pancreas tissue stained for SCGN/Secretagogin using ab244219 at 1/2500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SCGN/Secretagogin antibody [CL0271] (ab244219)
Paraffin-embedded human cerebellum tissue stained for SCGN/Secretagogin using ab244219 at 1/2500 dilution in immunohistochemical analysis.
-
Anti-SCGN/Secretagogin antibody [CL0271] (ab244219) at 1 µg/ml + Human brain tissue lysate
Predicted band size: 32 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244219 has not yet been referenced specifically in any publications.