Overview

  • Product name

  • Description

    Rabbit polyclonal to SCIN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human SCIN aa 556-703.
    Sequence:

    KGASQEEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQTSPLL ETQAEDHPPRLYGCSNKTGRFVIEEIPGEFTQDDLAEDDVMLLDAWEQIF IWIGKDANEVEKKESLKSAKMYLETDPSGRDKRTPIVIIKQGHEPPTF


    Database link: Q9Y6U3

  • Positive control

    • WB: Mouse stomach lysate. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 81 kDa (predicted molecular weight: 80, 66, 53 kDa).

Target

  • Function

    Ca(2+)-dependent actin filament-severing protein that is presumed to have a regulatory function in exocytosis by affecting the organization of the microfilament network underneath the plasma membrane. In vitro, also has barbed end capping and nucleating activities in the presence of Ca(2+). Regulates chondrocyte proliferation and differentiation. MAP kinases p38 and ERK1/2 mediate the adseverin-induced accelerated differentiation of non-hypertrophic chondrocytes.
  • Sequence similarities

    Belongs to the villin/gelsolin family.
    Contains 6 gelsolin-like repeats.
  • Cellular localization

    Cytoplasm, cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adseverin antibody
    • ADSV_HUMAN antibody
    • KIAA1905 antibody
    • Scin antibody
    • Scinderin antibody
    see all

Images

  • Anti-SCIN antibody (ab223055) at 1/500 dilution + Mouse stomach tissue lysate

    Secondary
    Goat Anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 80, 66, 53 kDa
    Observed band size: 81 kDa
    why is the actual band size different from the predicted?

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for SCIN (green) using ab223055 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG(H+L).

References

ab223055 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up