Overview

  • Product name

    Anti-SCMH1 antibody [OTI5E6]
  • Description

    Mouse monoclonal [OTI5E6] to SCMH1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SCMH1 aa 1-309. (NP_036368) produced in E.coli.
    Sequence:

    MQSYTPPSNEFKISMKLEAQDPRNTTSTCIATVVGLTGARLRLRLDGSDN KNDFWRLVDSAEIQPIGNCEKNGGMLQPPLGFRLNASSWPMFLLKTLNGA EMAPIRIFHKEPPSPSHNFFKMGMKLEAVDRKNPHFICPATIGEVRGSEV LVTFDGWRGAFDYWCRFDSRDIFPVGWCSLTGDNLQPPGTKVVIPKNPYP ASDVNTEKPSIHSSTKTVLEHQPGQRGRKPGKKRGRTPKTLISHPISAPS KTAEPLKFPKKRGPKPGSKRKPRTLLNPPPASPTTSTPEPDTSTVPQDAA TIPSSAMQA


    Database link: Q96GD3

  • Positive control

    • WB: HEK-293T transfected with pCMV6-ENTRY SCMH1, whole cell lysate. IHC-P: Human breast adenocarcinoma, colon adenocarcinoma, pancreatic carcinoma, prostate carcinoma and bladder tissue.
  • General notes

    Clone OTI5E6 (formerly 5E6).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI5E6
  • Isotype

    IgG2b
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236411 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/150.

Heat-induced epitope retrieval by Tris-EDTA, pH 8.0

WB 1/2000. Predicted molecular weight: 73 kDa.

Target

  • Function

    Component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.
  • Tissue specificity

    Strongly expressed in heart, muscle and pancreas. Weakly expressed in brain, placenta, lung, liver and kidney.
  • Sequence similarities

    Belongs to the SCM family.
    Contains 2 MBT repeats.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Polycomb protein SCMH1 antibody
    • SCMH 1 antibody
    • SCMH1 antibody
    • SCMH1_HUMAN antibody
    • Scml 3 antibody
    • Scml3 antibody
    • Sex comb on midleg 1 antibody
    • Sex comb on midleg homolog 1 antibody
    see all

Images

  • All lanes : Anti-SCMH1 antibody [OTI5E6] (ab236411) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY control, whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY SCMH1, whole cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 73 kDa

  • Paraffin-embedded human breast adenocarcinoma tissue stained for SCMH1 using ab236411 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon adenocarcinoma tissue stained for SCMH1 using ab236411 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic carcinoma tissue stained for SCMH1 using ab236411 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate carcinoma tissue stained for SCMH1 using ab236411 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder tissue stained for SCMH1 using ab236411 at 1/150 dilution in immunohistochemical analysis.

References

ab236411 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236411.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up