Overview

  • Product name

  • Description

    Rabbit polyclonal to Scn2b
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog
  • Immunogen

    Recombinant fragment corresponding to Human Scn2b aa 30-160.
    Sequence:

    MEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEM FLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYI MNPPDRHRGHGKIHLQVLMEEPPERDSTVAV


    Database link: O60939

  • Positive control

    • IHC-P: Human brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230093 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Crucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. The subunit beta-2 causes an increase in the plasma membrane surface area and in its folding into microvilli. Interacts with TNR may play a crucial role in clustering and regulation of activity of sodium channels at nodes of Ranvier.
  • Tissue specificity

    Brain specific.
  • Sequence similarities

    Belongs to the sodium channel auxiliary subunit SCN2B (TC 8.A.17) family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Neuronal voltage gated sodium channel beta 2 subunit antibody
    • Scn 2b antibody
    • Scn2b antibody
    • SCN2B_HUMAN antibody
    • Sodium channel beta 2 subunit antibody
    • Sodium channel subunit beta 2 antibody
    • Sodium channel subunit beta-2 antibody
    • Sodium channel voltage gated type II beta antibody
    • Sodium channel voltage gated type II beta polypeptide antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for Scn2b using ab230093 at 1/100 dilution in immunohistochemical analysis.

References

ab230093 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230093.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up