Overview

  • Product name
  • Description
    Rabbit polyclonal to SCNM1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human SCNM1 aa 1-230.
    Sequence:

    MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHR PVLDTLAMLTAHRAGKKHLSSLQLFYGKKQPGKERKQNPKHQNELRREET KAEAPLLTQTRLITQSALHRAPHYNSCCRRKYRPEAPGPSVSLSPMPPSE VKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSSG WIPDGRGRWVKDENVEFDSDEEEPPDLPLD


    Database link: Q9BWG6-1

  • Positive control
    • IHC-P: Human breast cancer tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Protein G purified
  • Purification notes
    Purity >95%
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239070 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance
    SCNM1 (Sodium channel modifier 1) contains a matrin-type zinc finger. It is thought to function as an RNA splicing factor. It is a disease modifier gene, that modifies phenotypic expression of SCN8A mutations in mice and is required for efficient in vivo splicing of a mutant splice donor site in the sodium channel SCN8A.
  • Cellular localization
    Nuclear
  • Database links
  • Alternative names
    • SCNM 1 antibody
    • Sodium channel modifier 1 antibody

Images

  • Paraffin-embedded human breast cancer tissue stained for SCNM1 with ab239070 at a 1/100 dilution in immunohistochemical analysis.

References

ab239070 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239070.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up