Overview

  • Product name
  • Description
    Mouse polyclonal to SCNN1B
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit
  • Immunogen

    Full length protein corresponding to Human SCNN1B aa 1-640.
    Sequence:

    MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRTICEGPKKKA MWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNA SPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPL VLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNR TQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACL FGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILD IGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDK LQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCN CGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCND TQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQ EFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWI TIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPN TGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI


    Database link: AAH36352.2

  • Positive control
    • Recombinant Human SCNN1B protein (ab132248) can be used as a positive control in WB. SCNN1B transfected 293T cell line lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 73 kDa.

Target

  • Function
    Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.
  • Involvement in disease
    Pseudohypoaldosteronism 1, autosomal recessive
    Liddle syndrome
    Bronchiectasis with or without elevated sweat chloride 1
  • Sequence similarities
    Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.
  • Post-translational
    modifications
    Phosphorylated on serine and threonine residues.
  • Cellular localization
    Apical cell membrane. Apical membrane of epithelial cells.
  • Information by UniProt
  • Database links
  • Alternative names
    • Amiloride sensitive sodium channel subunit beta antibody
    • Amiloride-sensitive sodium channel subunit beta antibody
    • Beta NaCH antibody
    • Beta-ENaC antibody
    • Beta-NaCH antibody
    • ENaC beta antibody
    • ENaCB antibody
    • Epithelial Na(+) channel subunit beta antibody
    • Epithelial Na+ channel beta subunit antibody
    • Epithelial Na+ channel subunit beta antibody
    • Epithelial sodium channel beta 2 subunit antibody
    • Epithelial sodium channel beta 3 subunit antibody
    • Nonvoltage gated sodium channel 1 beta subunit antibody
    • Nonvoltage gated sodium channel 1 subunit beta antibody
    • Nonvoltage-gated sodium channel 1 subunit beta antibody
    • SCNEB antibody
    • SCNN 1B antibody
    • SCNN1B antibody
    • SCNNB_HUMAN antibody
    • Sodium channel nonvoltage gated 1 beta (Liddle syndrome) antibody
    • Sodium channel nonvoltage gated 1 beta antibody
    see all

Images

  • All lanes : Anti-SCNN1B antibody (ab172276) at 1 µg/ml

    Lane 1 : SCNN1B transfected 293T cell line lysate
    Lane 2 : 293T cell line lysate (non-transfected)

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat anti-mouse HRP conjugated antibody at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 73 kDa

References

ab172276 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up