Overview

  • Product name

  • Description

    Rabbit polyclonal to SCNN1G
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human SCNN1G aa 302-371.
    Sequence:

    SEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAM VTSIGMHLTESFKLSEPYSQ


    Database link: P51170

  • Positive control

    • ICC/IF: RT4 cells.
  • General notes

     This product was previously labelled as epithelial Sodium Channel gamma

     

Properties

Applications

Our Abpromise guarantee covers the use of ab222191 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.
  • Involvement in disease

    Defects in SCNN1G are a cause of Liddle syndrome (LIDDS) [MIM:177200]. It is an autosomal dominant disorder characterized by pseudoaldosteronism and hypertension associated with hypokalemic alkalosis. The disease is caused by constitutive activation of the renal epithelial sodium channel.
    Defects in SCNN1G are the cause of bronchiectasis with or without elevated sweat chloride type 3 (BESC3) [MIM:613071]. A debilitating respiratory disease characterized by chronic, abnormal dilatation of the bronchi and other cystic fibrosis-like symptoms in the absence of known causes of bronchiectasis (cystic fibrosis, autoimmune diseases, ciliary dyskinesia, common variable immunodeficiency, foreign body obstruction). Clinical features include sub-normal lung function, sinopulmonary infections, chronic productive cough, excessive sputum production, and elevated sweat chloride in some cases.
  • Sequence similarities

    Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1G subfamily.
  • Post-translational
    modifications

    Phosphorylated on serine and threonine residues.
    Ubiquitinated; this targets individual subunits for endocytosis and proteasome-mediated degradation.
  • Cellular localization

    Apical cell membrane. Apical membrane of epithelial cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • Amiloride sensitive epithelial sodium channel gamma subunit antibody
    • Amiloride sensitive sodium channel subunit gamma antibody
    • Amiloride-sensitive sodium channel subunit gamma antibody
    • BESC3 antibody
    • ENaC gamma subunit antibody
    • ENaCG antibody
    • ENaCgamma antibody
    • Epithelial Na(+) channel subunit gamma antibody
    • Epithelial Na+ channel subunit gamma antibody
    • Gamma ENaC antibody
    • Gamma NaCH antibody
    • Gamma-ENaC antibody
    • Gamma-NaCH antibody
    • Nonvoltage gated sodium channel 1 subunit gamma antibody
    • Nonvoltage-gated sodium channel 1 subunit gamma antibody
    • PHA 1 antibody
    • PHA1 antibody
    • SCNEG antibody
    • SCNN 1G antibody
    • SCNN1G antibody
    • SCNNG_HUMAN antibody
    • Sodium channel epithelial 1 gamma subunit antibody
    • Sodium channel non voltage gated 1 gamma subunit antibody
    • Sodium channel nonvoltage gated 1 gamma antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized RT4 (human urinary bladder cancer cell line) cells stained for SCNN1G (green) using ab222191 at 4 µg/ml in ICC/IF.

References

ab222191 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222191.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up