Anti-SCRN2 antibody (ab234887)
Key features and details
- Rabbit polyclonal to SCRN2
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SCRN2 antibody -
Description
Rabbit polyclonal to SCRN2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human SCRN2 aa 176-425.
Sequence:GRLWAAQRIQEGARNISNQLSIGTDISAQHPELRTHAQAKGWWDGQGAFD FAQIFSLTQQPVRMEAAKARFQAGRELLRQRQGGITAEVMMGILRDKESG ICMDSGGFRTTASMVSVLPQDPTQPCVHFLTATPDPSRSVFKPFIFGMGV AQAPQVLSPTFGAQDPVRTLPRFQTQVDRRHTLYRGHQAALGLMERDQDR GQQLQQKQQDLEQEGLEATQGLLAGEWAPPLWELGSLFQAFVKRESQAYA
Database link: Q96FV2 -
Positive control
- WB: Hela, A-375 and HepG2 whole cell lysate. IHC-P: Human thyroid and glioma tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab234887 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/5000. Predicted molecular weight: 46 kDa. | |
IHC-P | 1/20 - 1/200. |
Target
-
Sequence similarities
Belongs to the peptidase C69 family. Secernin subfamily. - Information by UniProt
-
Database links
- Entrez Gene: 90507 Human
- SwissProt: Q96FV2 Human
- Unigene: 239718 Human
-
Alternative names
- scrn2 antibody
- SCRN2_HUMAN antibody
- Secernin 2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SCRN2 antibody (ab234887)
Paraffin-embedded human thyroid tissue stained for SCRN2 using ab234887 at 1/100 dilution in immunohistochemical analysis.
-
All lanes : Anti-SCRN2 antibody (ab234887) at 1/1000 dilution
Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Lane 2 : A-375 (Human malignant melanoma cell line) whole cell lysate
Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 46 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SCRN2 antibody (ab234887)
Paraffin-embedded human glioma tissue stained for SCRN2 using ab234887 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab234887 has not yet been referenced specifically in any publications.