Overview

  • Product name

  • Description

    Rabbit polyclonal to SCY1 like 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SCY1 like 3 aa 530-658.
    Sequence:

    PDWSEPEEPENQTVNIQIWPREPCDDVKSQCTTLDVEESSWDDCEPSSLD TKVNPGGGITATKPVTSAEQKPIPALLSLTEESMPWKSSLPQKISLVQRG DDADQIEPPKVSSQERPLKVPSELGLGEE


    Database link: Q8IZE3

  • Positive control

    • WB: SCY1 like 3 overexpression HEK-293T lysate. IHC-P: Human pancreas tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 83 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May play a role in regulating cell adhesion/migration complexes in migrating cells.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the protein kinase superfamily.
    Contains 4 HEAT repeats.
    Contains 1 protein kinase domain.
  • Domain

    The protein kinase domain is predicted to be catalytically inactive.
  • Post-translational
    modifications

    May be myristoylated; myristoylation may target it to Golgi compartment.
    Phosphorylated.
  • Cellular localization

    Cytoplasm. Golgi apparatus. Cell projection > lamellipodium. Colocalized with EZR/VIL2, actin and CD44 in lamellipodia.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ezrin binding protein PACE 1 antibody
    • Ezrin-binding protein PACE-1 antibody
    • PACE 1 antibody
    • PACE1 antibody
    • PACE1_HUMAN antibody
    • Protein associating with the carboxyl terminal domain of ezrin antibody
    • Protein-associating with the carboxyl-terminal domain of ezrin antibody
    • SCY1 like 3 (S. cerevisiae) antibody
    • SCY1 like 3 antibody
    • SCY1 like protein 3 antibody
    • SCY1 like pseudokinase 3 antibody
    • SCY1-like protein 3 antibody
    • SCYL 3 antibody
    • SCYL3 antibody
    see all

Images

  • Paraffin-embedded human pancreas tissue stained for SCY1 like 3 using ab224339 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-SCY1 like 3 antibody (ab224339) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) lysate
    Lane 2 : SCY1 like 3 overexpression HEK-293T (co-expressed with a C terminal myc-DDK tag, ~3.1 kDa) lysate

    Predicted band size: 83 kDa

References

ab224339 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224339.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up