Overview

  • Product name

    Anti-SDF2L1 antibody
  • Description

    Rabbit polyclonal to SDF2L1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse SDF2L1 aa 29-221. (Expressed in E.coli).
    Sequence:

    SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDA NSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQ EVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQY GNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL


    Database link: Q9ESP1

  • Positive control

    • IHC-P: Mouse testis tissue. WB: Mouse pancreas, testis and stomach lysates; Recombinant mouse SDF2L1 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231797 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 24 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Tissue specificity

    Ubiquitously expressed with high expression in testis, moderate expression in the pancreas, spleen, prostate, small intestine and colon. Very low expression is seen in brain and skeletal muscle.
  • Sequence similarities

    Contains 3 MIR domains.
  • Cellular localization

    Endoplasmic reticulum lumen.
  • Information by UniProt
  • Database links

  • Alternative names

    • PWP1-interacting protein 8 antibody
    • SDF2-like protein 1 antibody
    • SDF2L_HUMAN antibody
    • SDF2L1 antibody
    • Stromal cell-derived factor 2-like protein 1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for SDF2L1 using ab231797 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for SDF2L1 using ab231797 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-SDF2L1 antibody (ab231797) at 2 µg/ml + Recombinant mouse SDF2L1 protein

    Predicted band size: 24 kDa

  • Anti-SDF2L1 antibody (ab231797) at 1 µg/ml + Mouse pancreas lysate

    Predicted band size: 24 kDa

  • Anti-SDF2L1 antibody (ab231797) at 1 µg/ml + Mouse testis lysate

    Predicted band size: 24 kDa

  • Anti-SDF2L1 antibody (ab231797) at 1 µg/ml + Mouse stomach lysate

    Predicted band size: 24 kDa

References

ab231797 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231797.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up