Overview

  • Product name

  • Description

    Rabbit polyclonal to SDHA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, Zebrafish
    Predicted to work with: Cow, Pig, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human SDHA aa 44-664.
    Sequence:

    SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKL FPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMT EQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVA DRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGS IHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV QFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVV SRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLATRLPGISETAMIFAGV DVTKEPIPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQIVPGLYACGEAAC ASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDKVPPIKPNAGEESV MNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKISKLY GDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHA REDYKVRIDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTLEYRP VIDKTLNEADCATVPPAIRSY


    Database link: P31040

  • Positive control

    • WB: HeLa whole cell lysate; Mouse liver and spleen lysates; Rat heart lysate; Zebrafish lysate. IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 72 kDa.

Target

  • Function

    Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
  • Pathway

    Carbohydrate metabolism; tricarboxylic acid cycle; fumarate from succinate (eukaryal route): step 1/1.
  • Involvement in disease

    Defects in SDHA are a cause of mitochondrial complex II deficiency (MT-C2D) [MIM:252011]. A disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations. Clinical features include psychomotor regression in infants, poor growth with lack of speech development, severe spastic quadriplegia, dystonia, progressive leukoencephalopathy, muscle weakness, exercise intolerance, cardiomyopathy. Some patients manifest Leigh syndrome or Kearns-Sayre syndrome.
    Defects in SDHA are a cause of Leigh syndrome (LS) [MIM:256000]. LS is a severe disorder characterized by bilaterally symmetrical necrotic lesions in subcortical brain regions.
    Defects in SDHA are the cause of cardiomyopathy dilated type 1GG (CMD1GG) [MIM:613642]. CMD1GG is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
  • Sequence similarities

    Belongs to the FAD-dependent oxidoreductase 2 family. FRD/SDH subfamily.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CMD1GG antibody
    • DHSA_HUMAN antibody
    • Flavoprotein subunit of complex II antibody
    • Fp antibody
    • PGL5 antibody
    • SDH 2 antibody
    • SDH1 antibody
    • SDH2 antibody
    • SDHA antibody
    • SDHF antibody
    • Succinate dehydrogenase [ubiquinone] flavoprotein subunit antibody
    • Succinate dehydrogenase [ubiquinone] flavoprotein subunit mitochondrial antibody
    • Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial antibody
    • Succinate dehydrogenase complex flavoprotein subunit A antibody
    • Succinate dehydrogenase complex flavoprotein subunit antibody
    • Succinate dehydrogenase complex flavoprotein subunit precursor antibody
    • Succinate dehydrogenase complex subunit A antibody
    • Succinate dehydrogenase complex subunit A flavoprotein (Fp) antibody
    • Succinate dehydrogenase complex subunit A flavoprotein antibody
    see all

Images

  • All lanes : Anti-SDHA antibody (ab235594) at 1/500 dilution

    Lane 1 : Rat heart lysate
    Lane 2 : Mouse spleen lysate
    Lane 3 : Mouse liver lysate
    Lane 4 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 5 : Zebrafish lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 72 kDa

  • Paraffin-embedded human kidney tissue stained for SDHA using ab235594 at 1/50 dilution in immunohistochemical analysis.

References

ab235594 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up