Overview

  • Product name

  • Description

    Rabbit polyclonal to SEC13L1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human SEC13L1 aa 39-126.
    Sequence:

    IFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWRE ENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSD


    Database link: P55735

  • Positive control

    • Hela cell line

Properties

Applications

Our Abpromise guarantee covers the use of ab220955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100

 

Target

  • Function

    Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles.
  • Sequence similarities

    Belongs to the WD repeat SEC13 family.
    Contains 6 WD repeats.
  • Cellular localization

    Cytoplasmic vesicle > COPII-coated vesicle membrane. Endoplasmic reticulum membrane. Nucleus > nuclear pore complex. In interphase, localizes at both sides of the NPC.
  • Information by UniProt
  • Database links

  • Form

    It is a constituent of the endoplasmic reticulum and the nuclear pore complex. Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles. Cellular location: Cytoplasmic vesicle, Endoplasmic reticulum, Membrane, Nuclear pore complex, Nucleus.
  • Alternative names

    • D3S1231E antibody
    • Npp 20 antibody
    • Npp20 antibody
    • Protein SEC13 homolog antibody
    • SEC13 (S. cerevisiae) like 1 antibody
    • Sec13 antibody
    • SEC13 homolog (S. cerevisiae) antibody
    • SEC13 homolog antibody
    • SEC13 like 1 (S. cerevisiae) antibody
    • SEC13 like 1 isoform antibody
    • SEC13 like protein 1 antibody
    • SEC13 protein antibody
    • SEC13 related protein antibody
    • SEC13-like protein 1 antibody
    • SEC13-related protein antibody
    • SEC13_HUMAN antibody
    • SEC13R antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized Hela cell line labeling SEC13L1 with ab220955 at 4 µg/ml (green).

References

ab220955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up