Overview

  • Product name

    Anti-Sec14l3/TAP2 antibody
  • Description

    Rabbit polyclonal to Sec14l3/TAP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human Sec14l3/TAP2 aa 201-400.
    Sequence:

    GYNLMKPFLSEDTRRKIIVLGNNWKEGLLKLISPEELPAQFGGTLTDPDG NPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQINRGSSHQVEYEILFPG CVLRWQFSSDGADIGFGVFLKTKMGERQRAGEMTDVLPSQRYNAHMVPED GNLTCSEAGVYVLRFDNTYSFVHAKKVSFTVEVLLPDEGMQKYDKELTPV


    Database link: Q9UDX4

  • Positive control

    • WB: Mouse liver and lung lysates. IHC-P: Human testis and lung cancer tissue.
  • General notes

     This product was previously labelled as Sec14l3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab235110 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 46 kDa.

Target

Images

  • All lanes : Anti-Sec14l3/TAP2 antibody (ab235110) at 1/500 dilution

    Lane 1 : Mouse liver lysate
    Lane 2 : Mouse lung lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 46 kDa

  • Paraffin-embedded human testis tissue stained for Sec14l3/TAP2 using ab235110 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung cancer tissue stained for Sec14l3/TAP2 using ab235110 at 1/100 dilution in immunohistochemical analysis.

References

ab235110 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235110.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up