Overview

  • Product name

  • Description

    Rabbit polyclonal to Sec15
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human Sec15 aa 287-336 (internal sequence).
    Sequence:

    YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT


    Database link: NP_061926

  • General notes

    Previously labelled as EXOC6.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab104200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 94 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    Sec15 is a component of the exocyst complex involved in the docking of exocystic vesicles with fusion sites on the plasma membrane.
  • Database links

  • Alternative names

    • DKFZp761I2124 antibody
    • EXOC 6 antibody
    • EXOC6 antibody
    • EXOC6A antibody
    • Exocyst complex component 6 antibody
    • Exocyst complex component Sec15A antibody
    • FLJ1125 antibody
    • FLJ11251 antibody
    • MGC33397 antibody
    • SEC15 antibody
    • SEC15 like 1 antibody
    • SEC15 like protein 1 antibody
    • SEC15 like protein 3 antibody
    • SEC15A antibody
    • SEC15L antibody
    • SEC15L1 antibody
    • SEC15L3 antibody
    • Sec15p antibody
    see all

Images

  • Anti-Sec15 antibody (ab104200) (0.2-1 µg/ml) + Human Small Intestine

    Predicted band size: 94 kDa

References

ab104200 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up