Overview

  • Product name

  • Description

    Rabbit polyclonal to SEC62
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SEC62 aa 257-395.
    Sequence:

    GGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQK SDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHS SGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSS


    Database link: Q99442

  • Positive control

    • ICC/IF: A431 cells. WB: A431 cell lysate. IHC-P: Human cerebral cortex, prostate, endometrium and skeletal muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab244335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • PFA fixed, Triton X-100 permeabilized A431 (Human epidermoid carcinoma cell line) cells labeling SEC62 using ab244335 at 4 µg/ml (green) in ICC/IF.

  • Formalin-fixed, paraffin-embedded human endometrium tissue stained for SEC62 with ab244335 at a 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human skeletal muscle tissue stained for SEC62 with ab244335 at a 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for SEC62 with ab244335 at a 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human cerebral cortex tissue stained for SEC62 with ab244335 at a 1/50 dilution in immunohistochemical analysis.

  • Anti-SEC62 antibody (ab244335) at 0.4 µg/ml + A431 (Human epidermoid carcinoma cell line) cell lysate

References

ab244335 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up