Overview

  • Product name

  • Description

    Rabbit polyclonal to Sec8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Sec8 aa 834-968.
    Sequence:

    QHKFQYIFEGLGHLISCILINGAQYFRRISESGIKKMCRNIFVLQQNLTN ITMSREADLDFARQYYEMLYNTADELLNLVVDQGVKYTELEYIHALTLLH RSQTGVGELTTQNTRLQRLKEIICEQAAIKQATKD


    Database link: Q96A65

  • Positive control

    • WB: RT4 and U-251 MG sp cell lysates. IHC-P: Human duodenum tissue. ICC/IF: U-251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224484 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 110 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • All lanes : Anti-Sec8 antibody (ab224484) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 110 kDa

  • Paraffin-embedded human duodenum tissue stained for Sec8 using ab224484 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for Sec8 (green) using ab224484 at 4 µg/ml in ICC/IF.

References

ab224484 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224484.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up