Overview

  • Product name

    Anti-Secretin/SCT antibody
    See all Secretin/SCT primary antibodies
  • Description

    Rabbit polyclonal to Secretin/SCT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Horse, Guinea pig, Cow, Human
  • Immunogen

    Synthetic peptide corresponding to Mouse Secretin/SCT aa 17-66 (N terminal).
    Sequence:

    LSSSAALPAPPRTPRHSDGMFTSELSRLQDSARLQRLLQGLVGKRSEQDT


    Database link: NP_035458

  • Positive control

    • Mouse pancreas lysate.
  • General notes

     This product was previously labelled as Secretin

     

Properties

Applications

Our Abpromise guarantee covers the use of ab125326 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 15 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-Secretin/SCT antibody (ab125326) at 1 µg/ml + Mouse pancreas lysate at 10 µg

    Predicted band size: 15 kDa



    Gel concentration: 10-20%

References

ab125326 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab125326.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up