Overview

  • Product name

    Anti-Secretogranin 3 antibody
    See all Secretogranin 3 primary antibodies
  • Description

    Rabbit polyclonal to Secretogranin 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Secretogranin 3 aa 141-244.
    Sequence:

    LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLE DEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGL AKGE


    Database link: Q8WXD2

  • Positive control

    • WB: SH-SY5Y cell lysate. IHC-P: Human hippocampus tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224345 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 53 kDa.

Target

Images

  • Paraffin-embedded human hippocampus tissue stained for Secretogranin 3 using ab224345 at 1/200 in immunohistochemical analysis.

  • Anti-Secretogranin 3 antibody (ab224345) at 1/100 dilution + SH-SY5Y (human neuroblastoma cell line from bone marrow) cell lysate

    Developed using the ECL technique.

    Predicted band size: 53 kDa

References

ab224345 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224345.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up