Overview

  • Product name

    Anti-Secretogranin V antibody
    See all Secretogranin V primary antibodies
  • Description

    Rabbit polyclonal to Secretogranin V
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Pig, Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human Secretogranin V aa 80-201.
    Sequence:

    EGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDG CLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRK RRSVNPYLQGQRLDNVVAKKSV


    Database link: P05408

  • Positive control

    • IHC-P: Human pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224090 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Known variously as APPG, 7B2 and neuroendocrine protein I, Secretogranin V was originally isolated from porcine pituitary in 1983. It soon became evident that Secretogranin V-like immunoreactants were present in many cell types from a variety of species, and it is now recognised to be widely distributed in neural and endocrine tissues. In the early 1990s full length (27kDa) Secretogranin V was shown to be a potent inhibitor of prohormone convertase PC2 activity, a subtilisin-like enzyme responsible for the proteolytic cleavage of many neuroendocrine precursor molecules, including proenkephalin, POMC and gastrin-17. mRNA distribution analysis revealed that in adult rat brain, expression of Secretogranin V mRNA was pan-neuronal, whereas PC2 mRNA was exclusively neuronal, but more restricted. PC2+/Secretogranin V- cells were not encountered in the adult, but were common in developing rat brain. These findings suggest that Secretogranin V may have intracellular functions other than PC2 maturation in certain cells, although some recent work shows a discordancy between mRNA expression and enzymic activity. The mechanism for PC2 maturation appears to involve pro-Secretogranin V binding to inactive pro-PC2 via its polyproline motif (116 PPNPCP 121) in the endoplasmic reticulum and chaperoning pro-PC2 to a later secretory pathway compartment where maturation of PC2 proceeds once pro-Secretogranin V is proteolytically processed by a furin-like convertase into a 21kDa fragment and a C-terminal peptide. It is the C-terminal peptide that potently inhibits maturation of pro-PC2 until the complex is subjected to a decreasing pH gradient along the secretory pathway. It seems likely that mature PC2 then cleaves the CT peptide at its internal lys-lys site. Secretogranin V knockout mice develop a severe Cushings-like phenotype and exhibit multiple metabolic and hormonal abnormalities, indicating that Secretogranin V is required for activation of PC2 in vivo. Conversely, PC2-null mice appear to be viable.
  • Cellular localization

    Neuroendocrine and endocrine secretory granules.
  • Database links

  • Alternative names

    • 7B2 antibody
    • 7B2 protein antibody
    • APPG antibody
    • Neuroendocrine protein 7B2 antibody
    • P7B2 antibody
    • Pituitary polypeptide antibody
    • Prohormone convertase chaperone antibody
    • SCG 5 antibody
    • SCG5 antibody
    • Secretogranin 5 antibody
    • Secretogranin V 7B2 protein antibody
    • Secretogranin5 antibody
    • SecretograninV antibody
    • Secretory granule endocrine protein I antibody
    • Secretory granule neuroendocrine protein 1 7B2 protein antibody
    • Secretory granule neuroendocrine protein 1 antibody
    • Sg V antibody
    • SGNE 1 antibody
    • SGNE1 antibody
    • SgV antibody
    see all

Images

  • Paraffin-embedded human pancreas tissue stained for Secretogranin V using ab224090 at 1/50 dilution in immunohistochemical analysis.

References

ab224090 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224090.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up