Overview

  • Product name

  • Description

    Rabbit polyclonal to SelI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Chicken, Cow, Dog, Human, Pig
  • Immunogen

    Synthetic peptide corresponding to Rat SelI aa 58-107 (N terminal).
    Sequence:

    FMLLVFNFLLLTYFDPDFYASAPGHKHVPDWVWIVVGILNFVAYTLDGVD


    Database link: NP_001128226

  • Positive control

    • Rat small intestine lysate
  • General notes

    Previously labelled as EPT1. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab157571 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa.

Target

  • Function

    Catalyzes phosphatidylethanolamine biosynthesis from CDP-ethanolamine. It thereby plays a central role in the formation and maintenance of vesicular membranes. Involved in the formation of phosphatidylethanolamine via 'Kennedy' pathway.
  • Tissue specificity

    Widely expressed. Abundant in brain, placenta, liver and pancreas, followed by heart, skeletal muscle, lung and kidney. In brain it is strongly expressed in cerebellum, followed by the occipital pole and the frontal lobe.
  • Pathway

    Phospholipid metabolism; phosphatidylethanolamine biosynthesis; phosphatidylethanolamine from ethanolamine: step 3/3.
  • Sequence similarities

    Belongs to the CDP-alcohol phosphatidyltransferase class-I family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EPT1 antibody
    • EPT1_HUMAN antibody
    • Ethanolaminephosphotransferase 1 antibody
    • hEPT1 antibody
    • KIAA1724 antibody
    • Selenoprotein I antibody
    • SelI antibody
    see all

Images

  • Anti-SelI antibody (ab157571) at 1 µg/ml + Rat small intestine lysate at 10 µg

    Predicted band size: 44 kDa

References

ab157571 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Western blot
Sample
Mouse Cell lysate - whole cell (STHdhQ7/Q7)
Gel Running Conditions
Reduced Denaturing (4-20%)
Loading amount
40 µg
Specification
STHdhQ7/Q7
Blocking step
(agent) for 1 hour(s) and 0 minute(s) · Concentration: 50% · Temperature: RT°C

Abcam user community

Verified customer

Submitted May 01 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up