Overview

  • Product name

  • Description

    Mouse polyclonal to SelI
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human SelI aa 1-50. (NP_277040).
    Sequence:

    MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAP


    Database link: Q9C0D9

  • Positive control

    • HeLa whole cell lysate (ab150035); recombinant fragment of Human SelI protein (the immunogen).
  • General notes

    Previously labelled as EPT1. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 50% Glycerol
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab194554 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 45 kDa.

Use at 1/1500 - 1/1000 dilution for cell lysates and at 1/1000 - 1/2500 for recombinant protein.

Target

  • Function

    Catalyzes phosphatidylethanolamine biosynthesis from CDP-ethanolamine. It thereby plays a central role in the formation and maintenance of vesicular membranes. Involved in the formation of phosphatidylethanolamine via 'Kennedy' pathway.
  • Tissue specificity

    Widely expressed. Abundant in brain, placenta, liver and pancreas, followed by heart, skeletal muscle, lung and kidney. In brain it is strongly expressed in cerebellum, followed by the occipital pole and the frontal lobe.
  • Pathway

    Phospholipid metabolism; phosphatidylethanolamine biosynthesis; phosphatidylethanolamine from ethanolamine: step 3/3.
  • Sequence similarities

    Belongs to the CDP-alcohol phosphatidyltransferase class-I family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EPT1 antibody
    • EPT1_HUMAN antibody
    • Ethanolaminephosphotransferase 1 antibody
    • hEPT1 antibody
    • KIAA1724 antibody
    • Selenoprotein I antibody
    • SelI antibody
    see all

Images

  • Anti-SelI antibody (ab194554) at 1/1000 dilution + recombinant fragment of Human SelI protein (the immunogen) at 0.2 µg

    Predicted band size: 45 kDa

  • Anti-SelI antibody (ab194554) at 1/500 dilution + HeLa cell lysate at 50 µg

    Predicted band size: 45 kDa

References

ab194554 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194554.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up